KEGG   Agrobacterium sp. H13-3: AGROH133_12432Help
Entry
AGROH133_12432    CDS       T01432                                 

Definition
(GenBank) nitrate transport permease protein nrtB
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00910  Nitrogen metabolism
agr02010  ABC transporters
Module
agr_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    AGROH133_12432
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AGROH133_12432
Transporters [BR:agr02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    AGROH133_12432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADY66997
UniProt: F0LD37
LinkDB All DBs
Position
linear:complement(1388219..1389112)
Genome map
AA seq 297 aa AA seqDB search
MSALARNFKEQPQQPVVQKANVVTLPPKHPSRFNLRKLGAAAARNIIPPFVVLAVLLGVW
QVLCSAPGSSLPPPSQVFEESYDLIVSPFFHNGSQDIGLGLRVLVSLERVAYGFGLAAIA
GIILGAVIGQSIWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDSNPSAIFVIFITSIWPV
IINTAVGVRNIPQDYRNVAKVLRLNQIEFFFKIMLPSAAPYIFTGLRIGIGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVVGFMLDKLVAALGKVITRGAAAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcattggctcgaaatttcaaggaacagccgcagcaaccggtggtacaaaaggca
aacgtcgtgacccttccgcccaaacatccctcgcggttcaatctgcgtaaactgggtgct
gcggcggcccgcaatatcataccgccatttgtcgtcctcgccgttctgctaggcgtctgg
caggtgctctgttccgcccccggctcgtccctgccgccgccaagccaggtattcgaggaa
agctacgatctcatcgtatcgccgttcttccataatggttcgcaggatatcggcctcggc
ttgcgcgtgctggtctcgctggagcgtgtggcatacggtttcggccttgcggccatcgcc
ggcattattctcggtgcggtcatcggccagtcgatctgggccatgcgcggcctcgacccg
atttttcaggtcctgcgcaccgtgccgccgctcgcctggctgccgctttcacttgccgcc
tttcaggacagcaatccgtcggccattttcgtgatcttcatcacctccatctggcccgtc
atcatcaatacggcggtcggcgtgcgcaacattccgcaggattatcgcaacgttgcgaag
gtgctgcggctcaaccagatcgaattcttcttcaagatcatgctgccgtcggccgcgcct
tacatcttcaccggtctgcgcatcggcatcggcctctcctggctcgccatcgtggctgcg
gaaatgctgaccggcggcgtcggtatcggcttcttcatctgggatgcgtggaactcctcg
cgcctgcccgacatcatcgtggcgctcgcttacatcggcgttgtcggcttcatgctcgac
aagctggtagcggcgctcggcaaggtcatcacccgcggcgctgcggccaactaa

DBGET integrated database retrieval system