KEGG   Agrobacterium sp. H13-3: AGROH133_14508Help
Entry
AGROH133_14508    CDS       T01432                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:agr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AGROH133_14508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:agr03400]
    AGROH133_14508
Enzymes [BR:agr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AGROH133_14508
DNA repair and recombination proteins [BR:agr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AGROH133_14508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ADY67916
UniProt: F0LFT4
LinkDB All DBs
Position
pAspH13-3a:197700..200363
Genome map
AA seq 887 aa AA seqDB search
MSDNLSTYRGKRDFKKTAEPSGQAKVSASNRRRFVIQKHDATRLHYDLRLELDGVFKSWA
VTRGPSLDPGDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGKKTPEE
ALAKGDFKFTLEGDRLHGSFVLVRMRHDRDGGKRTNWLLIKHHDEFSVEENGAAVLEEND
TSVASGRTMEAIASGKGKKPKPFMLQSGALEADAVWDSNHGLAAEERKAGSKTAAKSAKK
PAAAKRAKSSMPDFVAPQLCETLSRPPSANGWIHEIKFDGYRIQMRVEDGEVTLKTRKGL
DWTAKWSAIAASASKLPDCIIDGEICALDENGAPDFAALQSALSEGKTGDLVFFAFDLLF
AGNEDLRELPLTKRKETLEGFLSDAGGDPLLRFVEHFETGGDAVLKSACRLSLEGIVSKK
ANAPYRSGRTETWAKSKCRAGHEVVIGAYAKTNGKFRSLLVGVNRGNHFVYVGRVGTGYG
AKVVEGLLPKLQEMETPKSPFTGIGAPKKSSDIVWLKPELVAEIEFAGWTGDGQVRQAAF
KGLREDKPAEEVEAEKPASPVENEVLDPETDKPAPRKFGKGAKVEVMGVMISSPDKPLWP
DAGDKEPVTKLDLARYHEAVGPWLIDHIKGRPCSIIRTPDGIGGEQFFQRHAMPGTSNLL
ELVTVFGDKKPYLQIDRVEGLAAIAQIGGVELHPWNCEPNQPEVPGRLVFDLDPGPDVEF
STVVEAAREIRDRLEDLGLVSFCKTTGGKGLHVVTPLAVPKGKKLSWDEAKGFAHDVCQD
MARDNPELYLIKMAKNQRNGRIFLDYLRNDRMATAVAPLSPRARPGATVSMPLNWSQVKT
DLDPKRFTIRTVPELLKKSTAWQDYCDGQRPLEQAIKRLAKSRKAAA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaatctctcaacttaccgcggcaagcgtgatttcaaaaagaccgccgaaccc
agcggacaggcgaaggtcagtgcgtcaaaccgtcgtcggttcgtgatccagaagcatgac
gcgacgcggctgcactacgaccttcggctggagctggacggagtgttcaagtcttgggct
gtgacaagaggtccctctctcgatccgggcgacaagcgccttgcggttgaagtggaagat
catccgctcgactacggagattttgaaggcacgatccccaaaggccagtacggcggcggg
acggtcatgctttgggatcgcggctattgggagccggagggaaagaagacgccggaagag
gcgctcgccaagggtgatttcaagttcacgcttgagggcgatcggctccatggcagcttc
gtgctcgtccgcatgcggcatgatcgcgatggcggcaaacgcacaaattggctgctgatc
aagcatcatgacgagttttcggtcgaagagaacggggccgcggttcttgaggagaacgat
acatcggtagcgtccggccggacaatggaagctatcgcatccggcaaaggtaaaaagcca
aaacccttcatgctgcagagcggcgcgctcgaagcggatgcggtgtgggacagcaatcac
ggtcttgctgccgaagagcgcaaggccgggtcaaagacagccgccaagtcagcgaagaag
cccgccgccgccaaacgcgccaaatcctcgatgccggactttgtcgcgccgcagctttgc
gagacgctgtcgcgtccgccatctgcaaatggctggatccatgaaatcaagttcgacggt
tatcgcatccagatgcgggttgaagacggtgaggtcaccctgaagacccgcaagggcctg
gactggaccgcgaaatggtctgcgattgctgcgtcggcatccaagcttcccgattgcatc
attgatggtgagatctgtgcccttgacgaaaacggcgcgcctgattttgctgccctgcaa
tcggcgctatcggaaggcaagaccggcgacctcgtctttttcgccttcgatctgcttttt
gccgggaacgaagaccttcgggagcttcctttgaccaagcgaaaggagacgcttgaaggc
tttctctcggatgcggggggcgatcctcttctccgcttcgtcgagcattttgagaccgga
ggcgatgcggtgctgaagtctgcttgccgcctgtctctggaaggcatcgtctcaaaaaag
gccaacgcgccctataggtctggccgcaccgagacctgggccaagtcgaaatgccgcgcc
ggccatgaagtggttatcggcgcctatgccaagaccaacggcaagttccgatcgctgctg
gtcggcgttaatcgcggtaaccacttcgtctatgtcggccgggtcggcacggggtatggc
gcaaaggtcgtcgaggggctcttgccgaagctgcaggagatggagaccccgaagtcacca
ttcacaggcatcggtgcgccgaagaaatcttccgacatcgtctggctcaaacccgaattg
gtcgccgaaatcgagttcgctggctggacgggtgatggccaggttcgacaggcggcgttc
aagggcttgcgggaagacaagccggctgaggaggtggaggctgagaagccggcgtccccg
gtcgaaaacgaagtactggatccagaaactgacaagccggcgccacggaagtttggcaag
ggcgcgaaggtggaggtgatgggcgttatgatctcgagtcccgacaagccgctttggccg
gatgccggtgacaaggaaccggtgaccaagctcgacctggcccgatatcatgaagcggtg
gggccatggttgatcgaccatatcaagggccgaccctgctcgatcatccgaaccccagac
gggattggcggtgagcagttcttccagcgtcatgccatgccggggacatccaacctgctt
gagctcgtcaccgtctttggcgacaagaagccctatctgcagattgatcgtgtcgaggga
ctggctgcgattgcccagatcggcggggtcgagcttcatccctggaactgcgagcccaac
cagccggaagtgccgggacggctggtcttcgaccttgatcctggtccggatgttgaattc
tccaccgtcgtcgaggccgcacgagaaatccgtgaccgcctagaagacctggggcttgtc
agcttctgcaagacgaccggaggaaagggcctgcatgtcgtcacgcccttggccgtgccg
aagggcaagaaactcagctgggatgaggcgaaaggcttcgcgcacgacgtctgtcaggat
atggcgcgcgacaatccagagctctacctcatcaagatggccaagaaccaacgcaatggc
cgcatcttcctagactatttgcgcaacgaccggatggcgacggcggtcgcgccattgtcg
ccgcgcgcacgtccgggcgcaaccgtatcgatgccgctcaactggagccaggtgaaaacg
gacctggatcccaaacggttcacgatccgcactgtgcccgagctgttgaagaagagcacg
gcatggcaagattactgtgacgggcaaagacctctggaacaggccatcaagcggctggca
aaatcgcgaaaggcggcggcttga

DBGET integrated database retrieval system