KEGG   Aphis gossypii (cotton aphid): 114119015Help
Entry
114119015         CDS       T05869                                 

Definition
(RefSeq) DNA repair protein complementing XP-G cells homolog
  KO
K10846  DNA excision repair protein ERCC-5
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ags00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    114119015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ags03400]
    114119015
DNA repair and recombination proteins [BR:ags03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     114119015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I
Motif
Other DBs
NCBI-GeneID: 114119015
NCBI-ProteinID: XP_027836268
LinkDB All DBs
Position
Unknown
AA seq 945 aa AA seqDB search
MGVQGLWKLLESAGKPIPVEKLENKVLSIDVSIWMYQIIKGVQESEHGATTNGHLIVMFH
RICKLLFYGIKPIFVFDGGVPELKKITIAQRQAQKNRAKKSTGKTKEKLLKNMLEQAALK
TVMNAENALSEDEVISKTVGRLNKGAETDLFELPNLPEPIEIDKKRVPIKEKDQSYTNLS
NENILLLAVENQNNDFLYANIAKDKEKSSPVKLNAFSSMQIGELLNGYSQDQKRLSEKKN
QQKLKREMTFNELEMFLNDDNKTINNIDEFSQKIDSDQDTVFYYESGINKSAKSSNLKNN
EMPKKIKTSNFEKSVEPESKSTSHKIITTDAIGSPTLTEDIDEDIFKALAGDESLEEDRL
AWLIFNENKIASKRRSSEFESPNIKCPKPDTGFSSGSEVLTSDIEEDETVKSNKVLSKKH
SSRSIFITEDDVSNENLNNFNEEDYLSWVSHSIDESSQTKKENKNSIINPQDIPSTSKAF
PFQENEDNISKRISVDQQHINESIYFASKSLKTEELNVFNNDSPTIESDNSNDSFSENSV
NFSPEESLSEDDAKLQDNKNIKYVNQVSDKKSDAPKVTKNEFKETNSTKNVIREKFNSPT
KCNNISTKWPKSPNNESSSMNEQYLQSIQDTLIKRQNDLASLHRTSDRMASSVTQKITSE
IKGLLKLFGIPYITAPMEAEAQCAFLEKIGRTEGTVTDDSDVWLFGANVVYKDFFDNQKY
VKQFKSIDIKQKFALSRNSFIQLAFLVGSDYTNGIDGIGPVSAIEILSFFESKTKNMNIE
EKLLKIKEIVNSKAEVYCDIPFMKKLKSTKIGNDFPNKAVINAYLHPIVNESIESFNWGT
LQVDSIVQFAQTNFDWDVSKTKSKLAPVLKKVSERTTQTTLDSFVKALPKLSNTNTGMSK
RVSQAVKRLRNDNSSVEYNKKSGNSKISLSDSNDITNKKRRKNLK
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtccaaggcttatggaaattattggaatcggctgggaaaccgattcctgtcgaa
aagttggagaataaagtactgagtattgatgtttcaatatggatgtaccaaataattaaa
ggtgttcaagaaagtgagcatggcgctacaacaaatggtcatttaatagtaatgtttcat
agaatatgtaaattattgttctatggtattaaaccaatatttgtatttgatggtggtgta
ccagagcttaaaaaaataactattgctcaaagacaagctcaaaaaaaccgtgccaaaaaa
tcaactggaaaaaccaaagaaaaattattaaaaaacatgttagaacaggcagccttaaaa
actgttatgaatgctgaaaatgcattgtctgaagatgaagtaatctctaaaactgttggc
cgtttgaataaaggagctgaaactgatttgtttgagctaccaaacctgccagaacccatt
gaaattgacaaaaaaagagtacctattaaggaaaaggatcagtcatacacaaatttatca
aatgaaaatattctattgttagctgtagaaaatcaaaataatgattttttatatgcaaat
attgccaaggacaaggaaaaaagttctcctgtgaaattaaatgcattttcatctatgcaa
attggggaacttttgaatggttattcacaagatcaaaaacgtttatcagaaaaaaaaaat
caacaaaaattaaaacgtgaaatgacatttaatgaattagaaatgtttttaaatgatgac
aataaaactattaataatatcgatgaatttagtcaaaaaattgattctgatcaagatact
gttttttattatgaatctggtatcaacaaatcagccaaaagtagtaatttaaagaataat
gaaatgcctaaaaaaataaaaacatcaaattttgaaaaaagtgttgaacctgaatcaaag
agtacaagccataaaattattaccactgacgccattggatcacctactttaacagaagat
attgatgaagatatatttaaagcacttgctggtgatgaatcccttgaagaagatagatta
gcatggctcatctttaatgaaaataaaatagctagtaaaagacgatcaagtgaatttgag
tcaccaaatataaaatgtcctaaacctgatacaggttttagtagcggttctgaagtatta
acatcagatattgaagaagatgaaactgtaaaaagtaacaaagttttgtccaaaaaacat
tcttccagaagtatttttattacagaagatgatgtatcaaatgaaaatttaaataatttc
aatgaagaagattatttatcatgggtatcccatagtatagacgaatctagtcaaacaaaa
aaggaaaacaaaaattcaatcattaaccctcaagatattccatctacaagcaaagctttt
ccatttcaagaaaatgaggataatatatctaaaagaatttctgttgatcaacaacatatc
aatgaatcaatatattttgcatcaaaatctttaaaaactgaagaattgaatgtatttaat
aatgattcgcccacaatagaatctgataattcaaatgattctttttctgaaaattctgtt
aatttttcacctgaagaaagtttatctgaggatgatgcaaaattacaagataataaaaac
ataaaatatgtcaatcaagtttctgataaaaagtcagatgctccaaaagttactaaaaat
gaattcaaagaaacaaattcaacaaaaaatgttataagagaaaaatttaattctccaaca
aaatgtaataatatttctacaaaatggcccaaatctcccaacaatgaatctagttctatg
aatgaacaatatttacagtccatacaagatacattaattaagcgtcaaaatgatttagct
agtttacacagaacatctgatcgaatggcttcttctgttacacaaaagattacatcggaa
ataaagggtctcttgaagctgtttggtataccatatataacagcaccaatggaagctgaa
gcacaatgtgcttttttagaaaaaattggacgaacagaaggtactgtgacagatgatagt
gatgtatggttgtttggagcaaatgttgtatataaagatttttttgataaccaaaaatat
gttaaacaattcaaaagtattgatattaaacagaaatttgctttatctagaaatagtttt
attcaattagcatttcttgtgggaagtgattacacaaatggaattgatggtattggtcca
gtatctgctatagaaattttatctttttttgaatccaaaactaaaaatatgaacattgaa
gaaaaattactaaaaattaaggaaattgttaattcaaaagctgaagtatattgtgatata
ccatttatgaaaaaattaaaatccaccaaaattggcaatgattttcctaataaagctgtt
ataaatgcttatctccacccaattgtaaatgaatcgattgaaagctttaattggggtaca
ctccaagtggactcgattgttcaatttgctcaaactaattttgattgggatgtttctaaa
acaaaaagcaaattagctcctgtattaaaaaaagtttctgaacgaacaacgcaaacaaca
ttagattcatttgtaaaagctcttcccaaattaagtaatacaaatactggtatgagtaaa
cgtgttagtcaagctgtcaaaaggttgcgaaatgataatagttctgttgaatataataag
aaatctggtaattcaaaaatatcattatctgattcaaatgatattactaataaaaaacgt
aggaaaaatctaaaataa

DBGET integrated database retrieval system