KEGG   Aphis gossypii (cotton aphid): 114123614Help
Entry
114123614         CDS       T05869                                 

Definition
(RefSeq) armadillo segment polarity protein-like
  KO
K02105  catenin beta 1
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:ags00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114123614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT_2 RasGEF_N_2 Adaptin_N Mo25 Cnd1 PUL Atx10homo_assoc Ric8 Arm_2
Motif
Other DBs
NCBI-GeneID: 114123614
NCBI-ProteinID: XP_027842455
LinkDB All DBs
Position
Unknown
AA seq 765 aa AA seqDB search
MSYQPRGMSGNMVNPINETMDIKDPSLVWQQSGQYLPDSGIQSGGSTQTHSITTKEDDME
RDRLLFDLDQGFPQSFPHDQVDNINQHLGQTCGENLEDEVEMPTQFNVNSAANVQNMTGP
SQMLKYAVVNLINYQDNAELATWAIPELIKLLNDEDQVVVSQAAVMVYQLSNREAALHAI
INSPQMIGTLVKSISNSNDLETTIGAVGTLRNLSNHRQGLLAIFKSGGIPALVKLMSSPV
VSILRDAVITIHNLLLHQDGSKMAVRVAGGLQKMISLLTFKSHTHSITVKFLTIITDCLH
ILACGNQESKLIILAAQGHVELVRIMRSYNYEKLLWLTCRVLKVLSVCSRNKPAIVEAGG
MQALAMHLQHDSQQLVYNVLWTLRNLSDAGTKVDGLEQLLQSLVAALGHTNINIVTCAAG
ILSNLTCNNQRNKLTVCQFGGVEALVRAIMNAGDNEEITKPAVCALRHITSGHAEVENAQ
NAVCRSGGAQVVAKLLQPSSHWPLIKAVIGLIKNIAQCKATHGLLREHSAIHNLVGLLMR
AFQDLQNHSNTSVKPEGVRMEEVIECVIGTLHILAKESQSRSIMRSHQGFMAILIQLLFN
NFENIQRLAADTLNELATDKEGADMIEAEGGTASLSELLHCGNEALATCAAAILSRVSEH
KLQKCLSMELSNSLFSEDQNLWPSGDLGIAPDLQDMIGANEYDMYGQGLSTVYSGVGSPK
HSASGYDTLPLDSMEGLEICPRQDSSYGSMDVDFVIQDDMTSLPL
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccaaccaagaggaatgtccggtaatatggtgaacccgataaacgagaccatg
gacatcaaagatccttctctagtatggcaacaaagtggtcagtatttaccagactctggc
atacaatctggaggtagcacccagacacattctataaccactaaagaagatgacatggaa
agggatcgacttctgtttgatcttgatcaaggattcccacaatcttttccacatgaccaa
gttgacaatattaatcaacatttaggccaaacatgtggtgaaaatttagaagatgaagtg
gaaatgcccactcaattcaatgtgaacagtgctgcaaatgtacaaaatatgactggacca
agtcaaatgttgaaatatgctgttgttaatttgatcaactatcaagataacgccgaactt
gcaacttgggctattccagaattgataaaattgttaaatgatgaagatcaagttgttgta
tcacaagctgctgttatggtttatcagttgtccaacagagaagctgctttgcacgcaatt
attaacagtccacaaatgattggaacattggttaaatctatatctaacagcaatgatcta
gaaaccacgatcggtgcagttggaacattacgaaatttgtctaatcaccgtcagggctta
ttagcaatttttaaaagtggaggaattccagctttggttaaattaatgagttctccagtt
gtaagcattttacgagatgctgtgattactattcataatttattattgcatcaagatggt
tccaaaatggctgttcgtgtagctggtggtttacaaaaaatgatatccttgttaacattc
aagtctcatacccactcgattactgttaagtttttaactatcataactgattgtcttcac
attttggcttgtggaaatcaagaaagcaaattgataatacttgctgctcaaggacatgtt
gaacttgtgcgtattatgcgctcatataattatgagaaattattatggctcacttgtcgt
gttcttaaagttctttcggtatgctcacgaaataaaccagctattgtggaagcaggtgga
atgcaagctttggcaatgcatcttcaacatgacagtcagcagttagtgtataatgtttta
tggactttgagaaacttatcagatgcaggaacaaaggttgatggattagaacaactattg
caatcattagttgcagcattgggtcacacaaatattaatattgtaacttgtgctgctgga
atattatcaaatttgacttgtaataaccagagaaataagttgactgtatgccagtttgga
ggtgttgaagctcttgtacgtgcaattatgaacgctggagacaatgaagagataactaaa
cctgctgtttgtgctctaagacatataacatccggacatgctgaagtggaaaacgctcaa
aatgcagtttgtcgttcaggaggtgcacaagttgtagccaagctattacaaccatcatct
cattggcctcttattaaagctgtaattggcttgataaaaaatatagcacaatgcaaagct
acacatggattacttcgtgaacatagtgccatacataatttagttggacttttaatgcgt
gctttccaagatcttcagaatcattcaaatactagcgtaaaaccagaaggagtccgaatg
gaagaggttattgaatgtgttattggaactttacacatattagctaaagaatcacaaagt
cgatcaataatgcgttctcaccaaggatttatggctatattaatacaattattatttaac
aactttgaaaatatacagcgtttagctgctgacacattaaacgagttagctacggataaa
gaaggtgccgacatgatagaagctgaaggaggaactgcctcacttagtgaattattacat
tgtggaaatgaagctcttgctacatgtgctgctgctattctatctagggtttctgaacat
aaattacagaaatgtctgtccatggaactcagtaactcattatttagtgaagatcaaaat
ttatggccatcgggtgatcttggtatagcaccagatcttcaggacatgataggtgcgaac
gagtatgatatgtatggtcaaggattgagcactgtctacagcggtgtagggtcacccaaa
cacagtgcttcagggtatgacacgctacccttagattcaatggaaggattagaaatttgt
cctcgacaagattccagttatggttcaatggatgttgattttgttattcaagatgacatg
acttctttgccactctaa

DBGET integrated database retrieval system