KEGG   Aphis gossypii (cotton aphid): 114124383
Entry
114124383         CDS       T05869                                 

Definition
(RefSeq) prostaglandin D2 receptor-like
  KO
K04332  prostaglandin D2 receptor
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ags00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114124383
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ags04030]
    114124383
G protein-coupled receptors [BR:ags04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    114124383
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4 zf-UBR
Other DBs
NCBI-GeneID: 114124383
NCBI-ProteinID: XP_027843421
LinkDB
Position
Unknown
AA seq 359 aa
MELAVTNATASSSPATPALPVMPSVSRSSNAGVQMGVTGLYAFGIFGNLLALFILHRTRS
SSNQKHGFMLRCLATNDCIALAGMLIQMFVSFKWPSTRNNVWSCRIRVLWRFFGLGSGCV
AIVMAVERWLALTKPFFYQKHISLRLLKRMMVILWLGVLCLVCAPYFGFGLYWDEKTSTC
VRYRTAKKPLDVLYAYLYFGHGVFLCFAIVYTNLAVMKALCMKDSPHNKHNVLMRRISRG
SSLTCNTTTKEERSFGWLMFLLCVAFVTCWVPQMISIPLSRFIDDETRIRPFTIAADMLL
AMHFALDPYLYVLQHWTLVKSICLKSKNKKNANGGSTSVSRSSSMRTTCFSWFTWPVLH
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggagctggccgtgacgaacgctaccgcgtcgtcgtcgcccgcgacgccggcacttccg
gtcatgccgtccgtttcccgttcgtcgaacgccggcgtgcagatgggagtcaccgggctg
tacgctttcggcatattcggcaacctgttggcgctgttcatattgcaccggacccggtcg
agcagcaaccagaaacacggtttcatgttgaggtgcttggccaccaacgattgcatcgcg
ctcgctggcatgctgatccagatgttcgtgagctttaagtggccgagcaccaggaacaac
gtgtggtcgtgccggatccgcgtcctgtggcggttcttcgggctgggctcggggtgcgtg
gccatcgtgatggctgtcgaacgctggctggcgctcaccaaaccgtttttttaccaaaag
catattagccttcgtctactcaaacgaatgatggtcatactttggttaggagtactgtgt
ttagtgtgcgcaccatacttcggatttggtctctattgggatgaaaaaacgtcgacgtgt
gtgcgttaccggacagccaaaaagcctttggacgtgctatacgcttacttatatttcggt
catggtgtatttttatgctttgcaatagtctacacaaacttagccgttatgaaagctcta
tgcatgaaggacagccctcacaacaagcacaacgtgttaatgagacgtatcagtcgagga
tcgtcattgacttgcaacacgactaccaaagaagaaagatcgttcggatggctcatgttt
ttgctgtgtgtcgcgtttgttacatgttgggtcccgcaaatgatatcgataccgttgtcc
agattcatcgatgacgagacgaggattcgaccgttcaccattgccgcggacatgcttctg
gctatgcacttcgcgctagacccatacttgtacgtgctccagcactggacgttagttaaa
tccatctgcttgaaatccaaaaataagaaaaacgctaacggaggcagcacgagcgtgagt
cgcagcagctccatgagaacaacatgtttttcgtggttcacatggccagtgttacactga

DBGET integrated database retrieval system