KEGG   Aphis gossypii (cotton aphid): 114126142Help
Entry
114126142         CDS       T05869                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit 1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags04140  Autophagy - animal
ags04213  Longevity regulating pathway - multiple species
ags04310  Wnt signaling pathway
ags04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:ags00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114126142
   04341 Hedgehog signaling pathway - fly
    114126142
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114126142
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    114126142
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ags01001]
    114126142
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ags03019]
    114126142
   03036 Chromosome and associated proteins [BR:ags03036]
    114126142
Enzymes [BR:ags01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     114126142
Protein kinases [BR:ags01001]
 Serine/threonine kinases: AGC group
  PKA family
   114126142
Messenger RNA biogenesis [BR:ags03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     114126142
Chromosome and associated proteins [BR:ags03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114126142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Bac_GDH
Motif
Other DBs
NCBI-GeneID: 114126142
NCBI-ProteinID: XP_027845825
LinkDB All DBs
Position
Unknown
AA seq 368 aa AA seqDB search
MTTRSLGALEGKKANAMGNAATANKKGDSAESVKEFLDQAKEDFEEKWKKNPTNTAALED
FDRIKTLGTGSFGRVMIVQHKASKEYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPF
LVSLKYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDL
IYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWW
ALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRFG
NLKNGVNDIKGHKWFASTDWIAVFQKKIEAPFIPRCKGPGDTSNFDEYEEEALRISSTEK
CAKEFAEF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcgttcgttgggagccctggaaggtaaaaaagcgaacgcgatgggcaacgcc
gcgacggctaacaagaaaggcgactcggctgagagcgtcaaagagttcctcgatcaggcc
aaggaggacttcgaggagaagtggaaaaagaaccccacgaacacggcggccctagaagat
tttgatcgtatcaagacgttaggtacgggctcgtttggccgtgtcatgattgtacaacat
aaggcttccaaggagtattatgctatgaaaatacttgacaaacagaaagtggtgaagttg
aaacaggtagaacacacgttgaacgaaaagagaattttacaagcaattagtttcccgttc
ctcgtcagtttgaaataccacttcaaggacaattccaatttatatatggtgcttgaatat
gtacctggaggtgaaatgttctctcacctgcgaaaggttggtcgttttagcgaaccacat
tcgcgtttttacgcggctcaaatagtgctagcattcgagtacctacactatcttgaccta
atctacagagatctcaagccagaaaacttgctgatcgattcgcagggctatttgaaagtg
actgactttggttttgcgaaacgtgtcaaagggcggacatggaccctgtgtggtacgcct
gaatatttggcacccgaaattatattaagcaagggatataacaaagctgtcgactggtgg
gctcttggagttctagtatacgagatggctgctggttatccaccattctttgccgaccaa
cctattcagatatacgagaaaattgtctcgggcaaagtacgtttcccatcacattttggt
tctgaccttaaagacctactgaggaatttgctacaagtggatctaaccaaacgatttgga
aacttgaagaatggtgtcaacgatatcaaaggacacaagtggtttgcatcaacagattgg
attgccgtgtttcagaagaaaattgaagctccgttcattcctaggtgcaaaggaccagga
gatacaagcaattttgatgaatatgaggaagaagcattgagaatctcttcaacagaaaaa
tgcgccaaagagtttgccgagttttaa

DBGET integrated database retrieval system