KEGG   Aphis gossypii (cotton aphid): 114126436
Entry
114126436         CDS       T05869                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00230  Purine metabolism
ags01100  Metabolic pathways
ags04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114126436
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    114126436
Enzymes [BR:ags01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     114126436
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 114126436
NCBI-ProteinID: XP_027846180
LinkDB
Position
Unknown
AA seq 1029 aa
MESAAKPTASPNAGRFADKATERLYQSYNAKQKRAAFACYVSASVLFDVYCLSVYDARSP
WTWCLLAANVVTLLWCRLAGGRRQYWTAVAHLAWLTADVQVVFHMVANAAEGADLLGWIL
LYDYLAYVSLPLTLALCIALSATTCVTYVLTMAVLGRQHAYLARQLATNSVLLLASNCLG
LLSYLLADKQQRTAFLETRQCLEMKMVIEEQSTEQERLLLSVLPEHVAVKMRQDLGEALD
SQFKKIYMSRHENVSILYADIVGFTAISSTYSASDLVKILNELFARFDRLSEKYQQLRIK
ILGDCYYCISGAPKERPDHAVLSVHMGLSMVKAIKYVQQTTNSPVDMRVGIHTGAVLAGV
LGQRQWQFDVYSKDVELANKMESSGMPGRVHISEKTLSFLNGEFEVEPGYGERREEALKM
ASIKTFFIIKTIKPFKMDVQNGSLTDQNSASKESVCATPIDDADIMAQAKEDSENFKKRL
RKDLMNRDGHRDLNKHTKFFTLAFNDDTKEREYKYHKEAASGVSLIGCPLVLFLTSSAQI
IMLPRDFLSYMSSCLALVLLLIIVVVSVADIFPRILPSKIVWFSETINDSLWIRRILGIT
AASLLASTNLVGLVSCWSDKQILTNCTHGQTDPSTYCMYPSYFTYFMVLALIATSMLTQL
SHFTKATILFVITLMHCIVNIVTVGTAIDCEDSLIYKPFKVLPSKYALSFLLIAVTMALI
FLARNMDKSSRVLYLWRTEVEEQRERASDIRRRNEALVYNILPPHVAKHFLGSYKRQHEE
LYSQSYAEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLEQPRYQDIIK
IKTIGSTYMAASGLNPSRVVKPEDPIEVRWAHLALLVDFAFDMKKALQGINEQSFNHFVL
KMGINHGPITAGVIGARKPHYDIWGNSVNVASRMESTGKAGCIQVTEETCNILQHFGFKF
EQRGLVAVKGKGQLMTYYLVGKGLQPSQAPPPIMETLPEVEEEDTDECMVVRQALLPRTD
HNGSTTASG
NT seq 3090 nt   +upstreamnt  +downstreamnt
atggaatccgcggcgaaaccgacggcgtcgccgaacgccggaaggttcgcggacaaggcc
accgagaggctgtaccagagctacaacgccaagcagaagcgcgcggcgttcgcgtgttac
gtgtccgcgtccgtgctgttcgacgtgtactgcctgtccgtgtacgacgcccggtcgccg
tggacgtggtgcctgctggccgccaacgtggtcacgctgctgtggtgccggctggccggc
ggccggcgccagtactggaccgccgtggcccacctggcctggctgacggccgacgtccag
gtggtgttccacatggtggccaacgcggccgagggcgccgacctgctcggatggatcctg
ctctacgattacctggcctacgtgtccctgccgctcacgctggccctgtgcatagccctg
agcgccaccacgtgcgtcacttacgtgctcaccatggccgtgctgggccgtcaacacgcg
tacctcgcccgacagttggccacaaacagcgttctccttttggcgtccaattgtttggga
ctcttgtcctatttactggccgacaagcagcagcggaccgcctttctggaaacccggcaa
tgtctcgagatgaaaatggtcatagaagaacaatcgaccgagcaggaacggctgttgttg
tccgtgttgccggaacacgtagccgtcaaaatgcgccaggatttgggtgaggcgttggac
agtcaattcaaaaagatatacatgagtagacacgaaaacgttagtatattgtatgctgac
atcgttggattcacggccatatcgtctacatactcggcttcggacctagtaaaaatcctc
aacgagctgtttgccagattcgatcgactttccgagaaataccaacagctcaggatcaag
attttgggcgattgttactattgtattagcggcgctcccaaggaacgacccgatcacgcc
gtgctgagcgttcacatgggactttccatggtcaaagctatcaagtacgtacaacaaacg
acaaattcgccggtggacatgcgagtgggcatacacacaggagccgttttagccggtgtc
ctgggccaaaggcagtggcagtttgacgtttactccaaggatgtggaattggcgaacaaa
atggaaagcagtggaatgccgggacgagtgcatatatccgagaaaactttgagtttctta
aatggagagttcgaagtcgagcccggttacggtgaacgtcgcgaagaagcgcttaagatg
gccagcataaaaactttcttcatcataaaaacaatcaaaccgttcaaaatggatgtgcaa
aacggatcgttgaccgatcagaacagtgccagtaaagaatcggtgtgcgctacaccgatt
gacgacgccgatatcatggctcaggccaaagaggactcagaaaactttaagaagcgattg
agaaaggacttgatgaacagagacggtcacagggacttaaacaaacatacaaaatttttc
actttggcatttaacgatgatacaaaagaacgtgaatacaaataccacaaagaagctgca
tctggtgtgtctcttataggttgtccgttggtactttttttgacgtcttccgcacaaatc
attatgttacccagagattttttaagctacatgtccagttgtcttgcattagtattacta
ttgattattgtagtcgtatcagtcgctgacatttttccaagaattctgccatcaaaaatt
gtatggttcagtgagaccataaatgactctttatggattcgacgtatacttggaatcact
gccgcatcattgctagcgtctaccaatcttgtgggactagtatcgtgttggtccgacaaa
caaatactaaccaactgcacacatggccaaaccgatccatcgacttactgtatgtatcca
tcatatttcacttacttcatggtgttggcattaatagctacgtccatgttgactcaatta
tcgcatttcaccaaagcaactatactgttcgtcattactctaatgcattgcattgtcaac
atagttacagtaggaacagctattgactgcgaagattcattaatttacaaaccattcaaa
gttttgccgtcgaagtatgcattgtcgtttctactcatagccgttacaatggcactaata
tttttggccagaaacatggacaaatcttcaagagttctttacctatggcggacggaagtt
gaagaacagagggaaagggcttcagatatacggagaagaaacgaagcattggtatacaat
atattaccaccgcacgtagccaaacatttcctaggtagttataaacgtcagcacgaagaa
ctatacagtcagagttatgccgaagttggagtattgtttgcatcaatgccaaacttttca
gacttctattcggaggagacggttaacaaccaaggcctggagtgcttaagatttcttaac
gaagttatatctgattttgatgcgcttctagaacaaccgcgttaccaggatattattaag
attaagacaattggttcaacttatatggctgctagtggactaaacccttcgcgtgttgta
aagcctgaagatcctattgaagttagatgggcacatcttgcattgctggtggactttgct
tttgatatgaaaaaagcacttcaagggataaatgaacaaagcttcaaccactttgtattg
aaaatgggaatcaatcatggtccgattactgcaggtgttattggtgcgagaaaacctcat
tacgatatttggggaaattctgtgaacgtggcgtcaaggatggagagcactggaaaggct
gggtgtatacaagtaacggaagaaacgtgtaatatcctacaacatttcggattcaagttc
gaacagcgtggtcttgtggccgtcaagggcaaggggcagctgatgacctattacttggtg
ggcaaagggctccaacccagtcaggcaccacctccgatcatggaaacgctgccggaagtg
gaggaagaagacaccgacgagtgcatggtggttcgacaggcgctgttacctcggaccgat
cacaacgggtcgacaaccgcttccggttga

DBGET integrated database retrieval system