KEGG   Aphis gossypii (cotton aphid): 114127596
Entry
114127596         CDS       T05869                                 

Definition
(RefSeq) anaphase-promoting complex subunit 4-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:ags00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114127596
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114127596
NCBI-ProteinID: XP_027847681
LinkDB
Position
Unknown
AA seq 212 aa
MTVTYGVTGTTTDGGGAVNNGRRVLVAKTDSLSNVNNNNNSTSVNNNNNNGSASITGKAS
VLSVRRVLFGPPADPAETRAWLDRQLYAATAADSRSWNFDFVNERPLRDSPADRYAWERV
CPPKRRDEPTATDSATTATAQQQQQQQNRMAGKQQRQSKVTDFMTKTKKRPLSVVGRTLR
SNIKVLDESESANKRSRRSIPATTTTTTMMAI
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaccgttacgtatggcgtgacggggacgaccaccgacggaggaggtgccgtcaacaac
ggcaggagagtgctcgtggccaaaaccgattccctgagcaacgtcaacaacaacaacaac
agcaccagcgtcaacaacaacaacaacaacggatccgcgtcgatcaccggcaaagcgtcc
gtgttgagcgtgaggcgcgttctgttcggcccgccggccgatccggcggagacgcgggcg
tggctggacagacagttgtacgcggccaccgcggccgattcgcggtcgtggaactttgat
ttcgtcaacgaacgtccgctgcgcgacagcccggccgaccgttacgcgtgggaacgcgtc
tgtccgccgaagcgtcgcgacgagccgaccgcgacagattctgcaaccaccgccacagcg
caacagcaacaacaacaacaaaacagaatggctggcaagcagcagcgacaatctaaagtc
acagatttcatgaccaaaactaagaagcgaccattgagtgttgttggcagaacactacgt
tctaacatcaaagtcttggacgaatccgagtcagcaaacaagaggagtcgccgatctatc
ccggcgacgacgacgacgacgacgatgatggctatctaa

DBGET integrated database retrieval system