KEGG   Aphis gossypii (cotton aphid): 114130979Help
Entry
114130979         CDS       T05869                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00040  Pentose and glucuronate interconversions
ags00051  Fructose and mannose metabolism
ags01100  Metabolic pathways
Module
ags_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    114130979
   00051 Fructose and mannose metabolism
    114130979
Enzymes [BR:ags01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     114130979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Phosphonate-bd Methyltransf_16 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 114130979
NCBI-ProteinID: XP_027851887
LinkDB All DBs
Position
Unknown
AA seq 359 aa AA seqDB search
MANASINNENDNLTSVLYGVRDLRLEQRPIPKPGHNEVLLKIQRVGICGSDVHYLVHGAI
GHYIVKEPMVIGHEASGIVEKLGEGVKNLKVGDRVAIEPGASCRMCQFCKIGSYNLCPEM
KFCATPPIDGNLTRYYVHAADFCYKLPDHISLEEGALLEPLSVGVHACKRGGVKVGSTVL
ILGAGPIGLVTLITAKAMGATKIYITDLVEFRLNIAKEMGAYKTITVNRGDSDEQAIENV
KNEIGDELPDVTIDCSGFQQTIKMGIELTKSGGVLTIVGMGASSDVKLPLFNALSREVDI
RGVFRYANDYQDALALIAAGQINLKPLITHNFKIEETLEAFKTAETGAGNAIKVMIHCN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgcaagtattaacaacgaaaatgataatttgacatcagtactctatggtgtt
agagatttacgacttgaacaacggccaataccaaaacctggacataatgaagtattattg
aagattcaacgtgtaggaatatgtggttcagatgttcactatttagttcatggagctata
ggtcactatattgttaaagagcccatggttattggtcatgaagccagtggaattgtagag
aagcttggagaaggtgttaaaaatcttaaagttggtgatagagtggcaattgaaccaggt
gcatcatgtcgtatgtgtcagttttgcaagatcggttcatacaatttatgcccagaaatg
aaattttgtgctacaccacctatagatggaaatttgactcgttattatgtccatgctgca
gatttttgttataaattacctgatcatatatctttagaagaaggtgctctattagaacca
ctttccgttggagtccatgcttgtaaaagaggaggtgttaaagttggttctacagtatta
attttaggagctggaccaattggtttggttacattaatcaccgcaaaagctatgggagct
acaaaaatttatataacagatctggtagaatttcgattaaatatagccaaagaaatgggc
gcttacaaaacaattaccgtaaatagaggagattcagatgaacaagcaatagaaaatgtt
aaaaatgagattggcgatgaacttccagatgttactatcgactgtagtggttttcaacaa
acaattaaaatgggaattgagttaacaaaatctggaggagtattgacaattgttggtatg
ggagcatcaagcgatgttaaattaccattattcaatgcattatctcgagaagtagacatc
agaggagtatttcgctatgctaatgattaccaagatgcattggctttaatagctgcagga
caaataaatttgaagccattaatcactcataattttaaaattgaagaaacattggaagct
tttaaaacagctgaaactggtgctggtaatgcaattaaagttatgatacactgtaattag

DBGET integrated database retrieval system