KEGG   Aphis gossypii (cotton aphid): 114131083
Entry
114131083         CDS       T05869                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
ags  Aphis gossypii (cotton aphid)
Brite
KEGG Orthology (KO) [BR:ags00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ags04052]
    114131083
   00536 Glycosaminoglycan binding proteins [BR:ags00536]
    114131083
Cytokines and growth factors [BR:ags04052]
 Growth factors
  Growth factors (RTK binding)
   114131083
Glycosaminoglycan binding proteins [BR:ags00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   114131083
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 114131083
NCBI-ProteinID: XP_027852020
LinkDB
Position
Unknown
AA seq 179 aa
MDQQEEKFQSTYEVAASNNLSRNARVSNPNGHSSQKNQKPVIIDTRKIKHYGRRMKLNCR
HGYNILILQNGEVSSSDDDIDSHCIMEFTSMSPGHVRIRGVEANLFLAMNKDGLLYGEAD
PNNNATIFIEQPEGPYSAYLSLKYQRKKWYIAIKKNGKIKLGPTTKRGQHATHFLTIVV
NT seq 540 nt   +upstreamnt  +downstreamnt
atggatcaacaagaagaaaagtttcaatcaacatacgaagtcgcagcttctaataatttg
tcgaggaatgcacgcgtgtctaatcctaatggtcattcttctcagaagaatcaaaaacct
gtaattattgatacacgtaagattaaacattatggccgcaggatgaaattgaattgcagg
catgggtataatattttaattcttcaaaacggagaagtatccagttctgacgatgacata
gacagtcattgtataatggaattcacatcaatgtctcctggtcatgttcgtattagagga
gttgaagcaaatttgtttttagctatgaataaagatggacttctttatggagaggctgat
cctaataacaatgcaactattttcattgaacaacctgaaggtccttacagtgcatattta
tctttgaaatatcaacgaaaaaaatggtatatagctataaaaaaaaatggtaaaattaaa
ctaggcccaacaactaaaagaggacaacatgctacacattttttaacaattgttgtatga

DBGET integrated database retrieval system