KEGG   Aphis gossypii (cotton aphid): 114131668Help
Entry
114131668         CDS       T05869                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags00020  Citrate cycle (TCA cycle)
ags00190  Oxidative phosphorylation
ags01100  Metabolic pathways
ags01200  Carbon metabolism
Module
ags_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ags_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ags_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ags00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    114131668
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    114131668
Enzymes [BR:ags01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     114131668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA HI0933_like DAO FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 114131668
NCBI-ProteinID: XP_027852760
LinkDB All DBs
Position
Unknown
AA seq 659 aa AA seqDB search
MVGFLKIVNPISRSTYSKINNWSRPLIGTRNLHQTQYYSSKQNTAGTNAYSVIDHEYDAV
VVGAGGAGLRAAFGLVQEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEDDDWRWHMFD
TVKGSDWLGDQDAIHYLTREAPAAVIELENYGMPFSRTDEGKIYQRAFGGQSLQFGKGGQ
AHRTCCVADRTGHSLLHTLYGYSLKFNCNYFVEYFALDLIMDKGQCVGVIALCLEDGTIH
RFRAKNTVLATGGYARAYFSCTAAHTCTGDGQALASRAGIPMQDMEFVQFHPTGIYGAGC
LMTEGCRGEGGYLINGLGERFMEKYAPNAKELASRDVVSRSMTIEIMEGRGCGPEKDHVY
LQLYHLPAEQLHARLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYRGQVINPE
NGEDKVVPGLYACGEAACTSVHGANRLGANSLLELVVFGRSCALDIAKYNKPGDKIPQIS
DNAGEESITNIDKLRFKNGTIPTADLRLDMQKTMQLYAAVFRTGSTLDEGRNKMQSIYSK
LKDIKINDRSMVWNSDLVESLELQNLMITAQQTIVSAAERKESRGAHARDDFKDRVDEFD
YKKPLEGQTEVPIEKHWRKHTLAHINPDSGEIKLTYRPVIDHTLDDKEVKSVPPMIRSY
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggttggctttcttaaaattgtcaatccaatatcacgaagtacttattcaaaaattaat
aattggagccgtccattaattggcacaagaaacttacatcaaacccaatactattcatca
aaacagaatacagcaggaactaatgcatattcagtaattgatcatgaatatgatgctgtc
gtggttggtgctggaggagcaggtctccgtgctgcttttggcttagtacaagaaggattt
aagacagcagttattactaaactttttcccactagatcgcatacagttgctgctcaagga
ggaattaatgctgctttagggaatatggaagatgatgattggcgatggcatatgtttgat
actgttaaaggttcagattggttaggagatcaggatgctatacattatttaactagagaa
gctcctgcagctgtcattgagctagaaaattatggtatgccttttagtcgtacagatgaa
ggcaaaatatatcaacgtgcttttggtggtcagagcttacaatttggaaaaggtggtcaa
gctcatcgtacttgttgtgtagctgacagaacgggtcattccctcttgcatactttatat
ggatattcattaaaatttaattgcaactactttgtagaatattttgctttggatttaatt
atggataaaggacaatgtgtcggagttattgccttatgtttagaagatggtactattcat
cgctttagagcaaagaatacagttttagctactggtggttatgctagagcctacttttca
tgtacagctgcccatacttgtacaggcgatggtcaagctttggcatcaagagctggcatt
ccaatgcaagatatggaatttgtacaattccaccctactggtatctatggtgctggctgt
ttaatgacagagggttgtcgtggtgaaggaggatatttaattaatggtttaggtgaaaga
tttatggaaaaatatgcacctaatgctaaagaacttgcatccagagatgttgtatctagg
tcaatgactattgaaatcatggaaggaagaggatgtggtccagaaaaagatcatgtttat
ctccaactgtatcatttaccagctgaacaacttcatgctagattaccaggtatttcagaa
accgccatgatatttgctggagttgatgttaccaaagagcctatacctgtgttgccaaca
gtccattataacatgggtggaataccgacaaactacagaggacaggttatcaatcctgaa
aatggagaagataaagtagtacctggattgtatgcttgtggagaagctgcatgtacttct
gttcatggagctaatcgccttggggctaattcattactcgagttagtggtatttggacgt
tcatgtgcattagatattgctaaatataataaacctggagataaaataccacaaatatct
gataatgctggtgaagaatcaattaccaacattgataaattacgttttaaaaatggaacg
atacctacagcagacttacgtttagatatgcaaaaaaccatgcaactttatgcagctgtt
tttagaactggatctacacttgacgaaggtcgtaataaaatgcaatccatttattcaaag
cttaaggatattaagataaatgatcgatcaatggtttggaattcagatttagtggaatca
ttagaactacaaaacttaatgattactgcacagcaaacaattgtatctgctgctgaacgt
aaagagtccagaggggcacatgcacgagatgatttcaaagatcgtgttgatgaatttgat
tacaaaaaaccgttagaaggacaaactgaagtacctattgaaaaacactggaggaagcat
acacttgcacacatcaatccagactctggagagataaaattaacttatagacctgtgatt
gatcatactttggatgataaagaagtgaaatcggtgccacctatgattagatcttattaa

DBGET integrated database retrieval system