KEGG   Aphis gossypii (cotton aphid): 114131810
Entry
114131810         CDS       T05869                                 

Definition
(RefSeq) uncharacterized protein LOC114131810
  KO
K20017  Bcl-2 family protein
Organism
ags  Aphis gossypii (cotton aphid)
Pathway
ags04214  Apoptosis - fly
ags04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:ags00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    114131810
   04215 Apoptosis - multiple species
    114131810
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 114131810
NCBI-ProteinID: XP_027852917
LinkDB
Position
Unknown
AA seq 203 aa
MIYRARPMTERNGRCSPAVKIADSSSGRCNEARRMSEGGLVMSSCAAANFNNNNTTNANN
NNVAAGLAVDCARRGRADQLPAASVVLVSVSRELFRAGAQVTWAKVVSLVCVAAGLAVDC
ARRGRADQLPDLIEAVGEVIEDDLAAWIHYNGGWMGLQSYCKPVVINVENPVSTQILYLV
SLLIVVIFFLLLLRWFNFISVFR
NT seq 612 nt   +upstreamnt  +downstreamnt
atgatataccgtgcgcgtccgatgactgaacgcaacggtcggtgttcgccggcggtgaaa
atcgccgacagttcttccggccggtgtaatgaagcgcggcgtatgtccgaaggtggtctc
gtcatgtcttcatgcgcggctgccaacttcaacaacaacaacaccacaaacgcaaacaac
aacaacgtggccgccgggttggcggtcgactgcgcgcgccgcggccgcgccgatcagctg
cccgccgcttccgtcgtcctggtgtccgtgtcccgggagctgttccgggccggcgcccag
gtcacgtgggccaaagtcgtgtcgctcgtgtgcgtggccgccgggttggcggtcgactgc
gcgcgccgcggccgcgccgatcagctgcccgacctgatcgaggccgtcggcgaagtgatc
gaggacgatctggccgcttggatacactacaacggcggatggatgggccttcagtcgtac
tgcaaaccagtggttatcaacgtcgaaaatcctgtgtccactcaaatcctgtatttagta
tcattgctcatagttgtcatatttttcttattgttattgaggtggttcaacttcatatcc
gttttccgatga

DBGET integrated database retrieval system