KEGG   Agrobacterium sp. 33MFTa1.1: EYD00_00685Help
Entry
EYD00_00685       CDS       T05906                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
agt  Agrobacterium sp. 33MFTa1.1
Pathway
agt00071  Fatty acid degradation
agt00280  Valine, leucine and isoleucine degradation
agt00281  Geraniol degradation
agt00310  Lysine degradation
agt00362  Benzoate degradation
agt00380  Tryptophan metabolism
agt00410  beta-Alanine metabolism
agt00640  Propanoate metabolism
agt00650  Butanoate metabolism
agt00903  Limonene and pinene degradation
agt00930  Caprolactam degradation
agt01100  Metabolic pathways
agt01110  Biosynthesis of secondary metabolites
agt01120  Microbial metabolism in diverse environments
agt01130  Biosynthesis of antibiotics
agt01200  Carbon metabolism
agt01212  Fatty acid metabolism
Module
agt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:agt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EYD00_00685
   00650 Butanoate metabolism
    EYD00_00685
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EYD00_00685
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EYD00_00685
   00310 Lysine degradation
    EYD00_00685
   00380 Tryptophan metabolism
    EYD00_00685
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EYD00_00685
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EYD00_00685
   00281 Geraniol degradation
    EYD00_00685
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EYD00_00685
   00930 Caprolactam degradation
    EYD00_00685
Enzymes [BR:agt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EYD00_00685
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EYD00_00685
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EYD00_00685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 UDPG_MGDP_dh_N GIDA 2-Hacid_dh_C FAD_binding_3 ApbA NAD_binding_8 Pyr_redox_2 Pyr_redox NAD_binding_7 F420_oxidored NAD_Gly3P_dh_N Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: QBJ12072
LinkDB All DBs
Position
circular:142808..145024
Genome map
AA seq 738 aa AA seqDB search
MSTYTNFTIETDADGIALVTWDMPEKSMNVFTSEVMDELNAILDATVADSAVKGVVFTSG
KSTFSGGADLSMIKSMFSFYNDEKTKNPDQAAAKLFELVGRMTGLFRKIETNGKPWVSAI
NGTCMGGAFELSLACHGRVASSAKNLKIALPEVKVGIFPGAGGTQRVSRLTDAQSALQMM
TTGQSLTGARAKAMGLVHQVVEPDQLVATAKQMIKDGLKPVAPWDEKGFKAPGGGIWTPA
AAQLWPAAPAILRRESAGNYPAALAILKCVYEGLQLPFDTALKVEQRYFTEILRSKEAFG
MIRSLFISMQELGKGARRPAGQPKTEFKKVGVVGAGFMGAAVAYVTAAAGIPVTLVDRDQ
EAADKGKGHCEESVKAAIGKGRLTQDEGKALLDLVTPTADYTALSDADLVIEAVFEDRDV
KKAVIEAVEAVLPEGAIFASNTSTLPITGLAKNSRRPTDFIGIHFFSPVEKMMLTEVILG
KETGDKALAVALDYVAKIKKTPIVVNDTRGFFVNRCVLRYMAESYDMLIEGVPPAMIENA
AKFAGLPVGPLALNDEVAIDLSYKILKATVADLGEKAVDPRHMELVKKLVEGEGRFGRKN
AKGFYDYPPKPAKKSLWPGLKDLYPQQKPEDVDMEVLKQRFLVTVALEAARTVEEGIVTD
PREADVGSILGFGFAPYTGGALSYIDGMGVKSFVALAEKLSETYGTRFQPTPLLKEMAAK
GETFYGRFDPYASAAKAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttacaccaatttcaccatcgagacggacgcagacggcattgccctcgtcacc
tgggacatgccggaaaagtccatgaacgtcttcacgtcagaggtgatggacgagctgaac
gccattctcgacgccaccgtcgccgatagcgccgtcaagggcgtcgtcttcacgtcgggc
aaaagcaccttttccggcggcgccgatctgtcgatgatcaagtcgatgttctccttctac
aatgacgagaagacgaagaacccggatcaggcggcagcaaagctgttcgagctggtgggc
cgcatgaccggcctgttccgcaagatcgagaccaacggcaagccctgggtctccgccatc
aacggcacctgcatggggggcgctttcgaactgtcactcgcctgccacggccgcgtggcc
tccagcgccaagaacctcaagatcgcactgccggaagtcaaggtcggcatcttcccgggc
gctggcggcacccagcgcgtctcgcgcctgaccgatgcacaatctgccttgcagatgatg
acgacaggccagtcgctgaccggcgcacgcgccaaggccatggggctggtgcaccaggta
gtcgagccggatcagctggtcgcaactgcaaagcagatgatcaaggacggcctgaagccg
gtagcaccctgggatgagaagggcttcaaggcccccggcggcggcatctggacgcctgcg
gctgcccagctgtggcccgccgctccggcgatcctccgccgcgaaagtgccggcaattat
ccggccgcactcgccatcctcaaatgcgtttatgaagggctgcaattgcctttcgatacg
gcgctgaaggtggagcagcgttatttcaccgaaatccttcgctcgaaggaagccttcggc
atgatccgctcgctgttcatttccatgcaggagctgggcaagggcgcgcgccgtccggcc
ggccagcccaagacggagttcaaaaaggtcggcgtcgtcggcgcgggcttcatgggggcg
gccgtcgcttacgtcaccgccgcagcgggtattcccgtcacgctggtggatcgcgatcag
gaagccgcagacaagggcaagggccattgcgaggaaagcgtcaaggccgccatcggcaag
ggcaggctgacgcaggatgaaggcaaggccctgctcgatctcgtcaccccaacggcggat
tacactgcattatctgatgcggatctcgtcatcgaagccgtctttgaagaccgcgacgtg
aagaaagccgtcatcgaagccgtggaagccgttttgcccgaaggcgcaatctttgcctcc
aacacgtccaccttgccaatcacggggctggcaaagaactccaggcgtccgaccgatttc
atcggcatccacttcttctcgccggtcgagaagatgatgctgacggaagtgatcctcggc
aaggaaaccggcgacaaggcgctcgccgtcgcgctggattatgtggccaagatcaagaag
accccgatcgtcgtcaacgacacccgcggcttcttcgtcaatcgctgcgtgctgcgttac
atggccgaaagctacgacatgctgatcgaaggcgtgccgcccgcgatgatcgaaaatgca
gcgaaattcgccggcttgccggtcggccccttggcgttgaacgacgaagtggccatcgat
ctttcctacaagatcctgaaagccaccgtcgccgatctcggcgaaaaggcggtcgatccg
cgccatatggagctggtgaagaagctggtggaaggcgagggccgctttggccgtaagaac
gccaagggcttttacgactacccgccaaagcccgccaagaagtccctctggcctggcctg
aaggacctctatccgcagcagaagcctgaagacgtggatatggaggtgctgaagcagcgc
ttcctcgtcaccgtggcgctggaagccgcccgcacggttgaagagggcatcgtcaccgat
ccgcgtgaggcggatgtcggttccatcctcggtttcggcttcgcgccctataccggaggc
gcgctgtcctacattgacggcatgggcgtgaagagcttcgtcgcgctcgccgaaaagctc
agcgagacatacggaacgcgcttccagccaacgccgctgctgaaggagatggccgccaag
ggcgagaccttctacggtcgcttcgatccctatgccagcgccgcgaaggcggcctga

DBGET integrated database retrieval system