KEGG   Agrobacterium sp. 33MFTa1.1: EYD00_06050Help
Entry
EYD00_06050       CDS       T05906                                 

Definition
(GenBank) beta-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
agt  Agrobacterium sp. 33MFTa1.1
Pathway
agt00061  Fatty acid biosynthesis
agt00780  Biotin metabolism
agt01100  Metabolic pathways
agt01212  Fatty acid metabolism
Module
agt_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:agt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EYD00_06050
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EYD00_06050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:agt01004]
    EYD00_06050
Enzymes [BR:agt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     EYD00_06050
Lipid biosynthesis proteins [BR:agt01004]
 Fatty acid synthase
  Component type
   EYD00_06050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: QBJ12996
LinkDB All DBs
Position
circular:complement(1195275..1195754)
Genome map
AA seq 159 aa AA seqDB search
MLLEYFQMIDKVEAVDMTARTLKARSVVPDKSPVFEGHFPGMPLVPGVLLIETMAQASGM
LVLAFSDFASMPFLMSVDGAKMRTFVEPGAVLDIEAVLEHDGSGFAVTKAKITSDGKKVC
DAQLKLRTMPFSEIPLGPIVKKRAEEVGLMAAIAADARK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgaatatttccagatgatcgacaaggtcgaggccgtggacatgacggcgcgc
acgttgaaggcgcggtccgttgttcccgataaaagcccggttttcgaaggccatttcccc
ggcatgccgctggttccgggtgtgcttctgatcgagacaatggcgcaggcctccggcatg
ctggttctggcattttccgatttcgcgtccatgccgttcctgatgtcggtcgatggcgcc
aagatgcggactttcgtggagccgggtgctgttctcgacatcgaggcagtgcttgagcat
gacggttcgggctttgcggttaccaaggcaaagatcacctccgatggcaaaaaggtctgc
gacgcgcagctgaaactgcgcaccatgcccttcagcgagatcccgcttgggcctatcgtc
aagaagcgggcggaagaagttggcctgatggcggcgattgccgccgatgcacggaaataa

DBGET integrated database retrieval system