KEGG   Agrobacterium sp. 33MFTa1.1: EYD00_08000Help
Entry
EYD00_08000       CDS       T05906                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
agt  Agrobacterium sp. 33MFTa1.1
Brite
KEGG Orthology (KO) [BR:agt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:agt03012]
    EYD00_08000 (tuf)
   03029 Mitochondrial biogenesis [BR:agt03029]
    EYD00_08000 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:agt04147]
    EYD00_08000 (tuf)
Translation factors [BR:agt03012]
 Eukaryotic Type
  Elongation factors
   EYD00_08000 (tuf)
 Prokaryotic Type
   EYD00_08000 (tuf)
Mitochondrial biogenesis [BR:agt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    EYD00_08000 (tuf)
Exosome [BR:agt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EYD00_08000 (tuf)
  Exosomal proteins of breast cancer cells
   EYD00_08000 (tuf)
  Exosomal proteins of colorectal cancer cells
   EYD00_08000 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: QBJ13340
LinkDB All DBs
Position
circular:complement(1554266..1555441)
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKFFGEFKAYDQIDAAPEEKARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALVRGVNRDGVERGQILCKPGSVKPHK
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaagtttgagcggacgaagccgcacgtcaacattggcacgatcggtcac
gttgaccatggcaagacgtcgctgacggcagcaatcacgaagttcttcggcgagttcaag
gcgtatgaccagatcgacgcggctcctgaagagaaggctcgtggtatcacgatctcgacg
gcacacgttgagtacgagacggccaaccgtcactacgctcacgttgactgccccggccac
gccgactacgtgaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtt
tgctccgccgctgacggcccgatgccgcagacgcgcgagcacatcctgcttgcccgtcag
gttggcgttccggccatcgtcgtgttcctcaacaaggtcgaccaggttgacgacgccgag
cttctcgagctcgtcgagcttgaagttcgcgaacttctgtcgtcctacgacttcccgggc
gacgatattccgatcatcaagggttcggcgcttgctgctcttgaagattccgacaagaag
atcggtgaagacgcgatccgcgagctgatggctgcggttgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgtggtacggttgtgacgggtcgcgttgagcgcggtatcgtcaaggttggtgaagaagtc
gaaatcgtcggcatccgtccgacctcgaagacgactgttaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggctggcgacaacatcggtgcactggttcgcggtgttaac
cgtgacggcgtcgagcgtggtcagatcctgtgcaagccgggttcggtaaagccgcacaag
aagttcaaggcagaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcacgaactaccgtccgcagttctacttccgtacgactgacgtgaccggcatcgtgacg
cttcctgaaggcacggaaatggttatgcctggcgacaacgtcaccgttgacgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgtacc
gtcggcgccggcatcgttgcctcgatcgtcgagtaa

DBGET integrated database retrieval system