KEGG   Agrobacterium sp. 33MFTa1.1: EYD00_18670Help
Entry
EYD00_18670       CDS       T05906                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
agt  Agrobacterium sp. 33MFTa1.1
Pathway
agt00564  Glycerophospholipid metabolism
agt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EYD00_18670
Enzymes [BR:agt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EYD00_18670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 STPPase_N Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: QBJ15471
LinkDB All DBs
Position
linear:1052057..1053580
Genome map
AA seq 507 aa AA seqDB search
MSDEAIHDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSAATKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHIIWPMRFVLPFQKGGVRPAWLVRLGLFLYDHLGGRKL
LPATRSLDLRRDPAGKPLKPIFARAFEYSDGWVDDARLVVLNARDAADRGALILNRTQVV
SARRDGAFWRVETRNAAGETQVHRARMLVNAAGPWVDRVLSATFGKNNVHNVRLVQGSHI
IVRKKFSDPRAYFFQNPDGRIIFAIPYEQDFTLIGTTDRDYTGDPRAVKISDEEISYLCS
AASEYFAEPVKPSDIVWTYSGVRPLFDDGASKAQEATRDYVLKTEGTDGEAPLLNIFGGK
LTTYRRLAEHALEKIGDALGTKGAPWTAGSHLPGGNFNVEAYAAEVSALLSRYPFLEKRH
AERLVRCYGTDVAAMIGNATDAPALGRYFGGTLYEAEVRWLMAREWALTAEDILWRRTKQ
GLFLTPDEVRGLEDYIDDIAGGRLKAI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgaggcaattcacgatattttcgtgatcggcggcggtatcaatggctgcggc
attgcgcgcgacgccgtcggcaggggctattccgtcgcacttgcggaaatgaacgatttc
gcctccggtacgtcgtctgctgcaaccaagctcattcatggcggcctgcgttatctcgaa
cattacgagtttcgtctggtgcgcgaagcactgatggaacgcgaggttctgtgggcgatg
gcgcctcatatcatctggcccatgcgtttcgtgctgcccttccagaagggcggtgtgcgt
ccggcgtggctcgtgcgtctcgggctcttcctttacgatcatcttggcggccgcaagctt
ctgcccgccacccgctcgctcgatctgcgccgtgatccggccggaaagcctttgaaaccg
attttcgcccgggctttcgaatattccgacggatgggtcgatgacgcccgcctggtcgtg
ctgaacgcccgtgatgccgctgaccgtggcgcgttgatcctcaatcggacgcaggtggtt
tccgcgcggcgcgacggcgcgttctggcgggtcgagacgagaaatgccgccggagaaacg
caggtccaccgggcgcggatgttggtgaatgccgccggtccatgggtcgacagggttctg
tcggcgaccttcggaaaaaacaacgttcacaatgttcgcctcgtccagggcagccatatc
atcgtgcgcaagaagttctccgatccgcgcgcctacttctttcagaatccggatggccgc
atcattttcgccatcccttacgaacaggatttcaccctgatcggcacgacggatcgcgac
tataccggtgacccccgggctgttaagatcagcgacgaggaaatcagctatctctgcagc
gcggcgagtgaatattttgccgaaccggtgaagccgtccgatatcgtctggacatattcc
ggggtgcggccgctttttgatgacggcgcgtcaaaagcgcaggaggcgacgcgtgattat
gtcttgaagaccgaggggaccgacggcgaggcaccacttctcaatattttcggcggcaag
ctcaccacttatcggcgactcgccgaacatgctcttgaaaagatcggcgatgcgctggga
acaaagggagccccatggacagcgggttctcatctgccgggcggaaatttcaatgtagaa
gcttatgctgcggaggtttctgcgctgctatcgcgttatcccttcctggaaaagcgtcat
gcggagcggcttgtccgctgctacggcaccgatgtggcggcgatgataggcaatgcgaca
gacgcgccggcgcttgggcggtatttcggcggcacgctctacgaagctgaagttcgctgg
ctgatggcgcgggaatgggcgctgacggcggaggatattctgtggcgccgtaccaagcag
gggctgtttttgacccccgacgaggtgcgtgggttggaggactacatcgatgacattgca
ggtggacgattgaaggcaatctga

DBGET integrated database retrieval system