KEGG   Acinetobacter guillouiae: AS4_14080Help
Entry
AS4_14080         CDS       T06251                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
agu  Acinetobacter guillouiae
Brite
KEGG Orthology (KO) [BR:agu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AS4_14080 (ahpF)
Enzymes [BR:agu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AS4_14080 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO FAD_binding_3 AlaDh_PNT_C Thi4 NAD_binding_8 K_oxygenase FMO-like Glutaredoxin Spermine_synth Cytochrom_C_2
Motif
Other DBs
NCBI-ProteinID: BAP36348
UniProt: A0A077KZL4
LinkDB All DBs
Position
1526881..1528446
Genome map
AA seq 521 aa AA seqDB search
MLDTNTSAQLKTLLERLESPIEIVASLNGSDKSDKIKELVTEIAALSDQVTARFDGQNDR
KPSFGIAKVGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDEILAQVKGLNLTANF
DVFVSLSCHNCPDVVQALNLIAINNPGTTATMIDGAFFQDEVEERKILAVPMVFQNGEHI
GQGRMTLEEIVAKLDSGAAAKDAEKLNAKDAFDVLVIGGGPAGATSAVYAARKGIRTGIV
SERFGGQVMDTMDIENFISVQKTQGPKFGSDMEAHVREYGVDIMNLQKVKNIVGADQTTH
GLVEVELENGAKLESKTVILSTGARWREMNVPGEKEYKTRGVAYCPHCDGPLFKGKKVAV
IGGGNSGVEAAIDLAGIVEHVTLIEFDTQLRADQVLQDKLNSLPNTTVILNALSTEVIGD
GSIVTGLKYKDRATDELHTIELAGIFVQIGLLPNTDFLKATAVELSNRNEIVVNDRNETN
VKGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatacaaatacttctgctcaattaaaaacattgttagagcgtcttgagagccca
attgaaattgttgcttctttaaatggttctgataagtcagataaaattaaagaattggtg
actgaaattgctgcgctgtcagatcaagtgactgcacgtttcgatggtcagaatgatcgt
aaaccgagctttggtattgcaaaagtaggtgaacaacctcgtgtattctttgctggttta
ccgatgggtcatgagtttacctcgttaattttagctttattacaagtttcaggttatgcg
ccaaaagtttctgatgaaatcttggctcaagttaaaggtttaaacctgactgcaaatttt
gatgtatttgtttctttaagctgtcacaactgcccagatgttgttcaagcacttaacttg
attgcaattaataatcctggcactacagcgaccatgatcgatggtgcattcttccaagat
gaagttgaagagcgcaaaatcttggctgtacctatggttttccaaaatggcgaacatatt
ggtcaaggtcgtatgactttggaagaaatcgttgcgaaattggacagcggtgctgcggct
aaagatgctgaaaagctgaatgctaaagacgcgtttgatgtattggtgattggtggtggg
cctgctggtgcaacatctgcggtatatgctgcacgtaaagggattcgcacaggtattgtt
tctgagcgctttggtggtcaggtcatggacaccatggatattgaaaactttatctcagta
caaaaaacacaaggtcctaagtttggttcagatatggaagcgcatgtacgtgagtacggt
gtggacattatgaacttacaaaaagtgaaaaacattgttggtgcggatcaaacaactcat
ggtttagttgaagttgaactggaaaatggtgcaaaacttgaatcaaaaacggtcatctta
tctacaggtgcacgttggagagagatgaatgtaccaggtgagaaagagtacaaaacacgt
ggtgttgcgtattgcccacactgtgatggtccattatttaaaggcaaaaaggttgccgtg
attggtgggggtaactcaggtgtagaggccgcaattgatcttgcaggtattgttgaacat
gtcacattgatcgagtttgatactcaacttcgtgctgaccaagtgcttcaagataaattg
aatagtttgccaaataccacggtgattttgaatgcactctctacagaagtgattggtgat
ggttcgattgtgacagggttgaagtataaagaccgtgcaacagacgaactacataccatt
gaacttgcgggaatctttgtacaaattggtttattaccaaacacagatttcttaaaagca
actgctgtagagctttcaaaccgtaatgaaattgtggtaaatgatcgtaatgaaaccaat
gtaaaaggtgtatttgctgcgggtgactgtacaacagtgccttataaacaaatcatcatt
gcggctggtgagggtgcaaaagcctctttatctgcattcgattacatcattcgttcaggt
caataa

DBGET integrated database retrieval system