KEGG   Archaeon GW2011_AR10: QT03_C0001G0397Help
Entry
QT03_C0001G0397   CDS       T03835                                 

Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
agw  Archaeon GW2011_AR10
Brite
Enzymes [BR:agw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     QT03_C0001G0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF5041
Motif
Other DBs
NCBI-ProteinID: AJF59898
UniProt: A0A0B5HS16
LinkDB All DBs
Position
complement(341896..342504)
Genome map
AA seq 202 aa AA seqDB search
MAFELPKLPYAYNALEPYIDAKTMEIHHTKHHQTYIDKLNVAVKGTEWENKKIGEIIANL
NKVPEKIRGAVRNHGGGHYNHSIFWQIMAPKAGGSPSGEIGKSINSAFGTFDKFKEAFTN
AALGQFGSGWAWLVASNGKLEVVSTPNQDSPISQGKKPILGIDVWEHAYYLKYQNRRLEY
VEAFFNVINWKKVEELSRKARG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattaccaaaacttccttacgcttataatgctcttgagccgtacattgat
gcaaagacaatggaaattcaccacacaaagcaccatcagacttacattgacaagctcaat
gtggcagtgaaaggtacggaatgggaaaacaagaaaataggggaaataattgcaaacctg
aacaaggttcctgaaaaaatccggggtgctgtccgcaatcatggcggcgggcattataac
cactccattttctggcaaattatggcgcccaaagcaggaggaagcccgtcaggagaaata
ggaaaatccattaattcagcatttggcactttcgataagttcaaggaagcattcactaat
gcagcattaggccagtttggttcaggctgggcatggctcgttgcaagcaatggcaagcta
gaggtcgtttcaacgcccaatcaggattctccaatctcacagggaaagaaacccattctt
ggcattgatgtgtgggagcacgcgtattacctcaaataccagaacagaagactggaatac
gttgaggcattctttaacgtaatcaactggaagaaggtggaagagctctccagaaaggca
aggggataa

DBGET integrated database retrieval system