KEGG   Agromyces aureus: ATC03_01400Help
Entry
ATC03_01400       CDS       T04413                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
agy  Agromyces aureus
Pathway
agy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:agy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ATC03_01400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:agy03400]
    ATC03_01400
Enzymes [BR:agy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ATC03_01400
DNA repair and recombination proteins [BR:agy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ATC03_01400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ANJ25618
UniProt: A0A191WBP4
LinkDB All DBs
Position
328116..330623
Genome map
AA seq 835 aa AA seqDB search
MAEGARQLVEVDGRRLRLTNLDKVMYPETGMTKGEVIAYYAEIAPAMVPLVAGRPVTRLR
WVHGVGTADAPERPFFEKTLDEHAPEWLRRGVIRHSDGDKPYPIAGDRASLVWLAQQASL
EVHVPQWRFAADGQPANPDRIVFDLDPGEGMGLVECAEVARLVRALIGGMGLDAVPVTSG
SKGIHLYAALDGRQTSEQVSDVARELARALESDHPGLIVSSMSKIVRGGRVLIDWSQNNG
KKTTIAPYSLRGRARPTVAAPRTWEELDDPGLRHLEAHEVLERVASGIDPIASLADSGGG
AGGGAGPLATYLSMRTTGVTPEPMPGSSWAAPGGGAPGSSALSFVIQEHHARRLHYDFRL
ERDGVLKSWAVPKGVPEDPGVNHLAVQTEDHPLEYGGFEGTIPGGEYGAGSVTIWDAGTY
ATEKWRDDEVIVDVQGRVGGPLGAVRLALIRTGGEGEKSTWLLHRMKDQRPGEVVATVGS
RDGAGAPPRPAAGANPAGRGGSEASVSRPATPGAAEPITARPMLASPGTLGLVGAGDWAL
EYKWDGIRVLARTDGGGLRLVSRNGNDVTSRYPELAGLPGALRGDALVDGELVALDDDGR
PSFELLQSRMNLTRTREIQRLATSAPVRLLLFDVLEIAGDDVTDAPYRERRRRLERLVRP
GSGMPVEVPALATGSPADALAEARRLGLEGLVAKRPDSTYHPGTRSEQWLKLKLTRTQEV
VIGGYRVGVGSRTGRIRSLLVGIPGEHGLEYAGRVGSGLRELESERLLARLDAAVRETSP
FVDVPEADAVDAVWVEPQLVGEIELAEWTSTGVARHPRWRGLRPDKSPSEVVREA
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggccgagggtgcgcggcagttggtggaggtcgacggccggaggctccggctgacgaac
ctcgacaaggtcatgtatcccgagacgggcatgacgaagggcgaggtgatcgcctactac
gccgagatcgcgcccgccatggtgccgctcgtcgcgggtcgcccggtcacgaggctcagg
tgggtgcacggcgtcggaacggcggatgcccccgagcggccgttcttcgagaagacgctc
gacgagcacgcgcccgagtggctgcgccgcggggtgatccgccattccgacggcgacaag
ccgtatccgatcgccggcgatcgcgcctcgctcgtctggctcgcgcagcaggcgtcgctc
gaggtgcacgtgccgcagtggcggttcgcggccgacgggcagccggcgaatcccgaccgc
atcgtgttcgacctcgatccgggcgagggcatgggcctggtcgagtgcgccgaggtcgcg
aggctcgtgcgcgcgctcatcgggggcatggggctcgacgccgtgccggtcacgagcggc
agcaagggcatccacctctacgcggcgctcgacgggcggcagacctcggagcaggtgtcg
gatgtcgcgcgcgaactcgcgcgcgccctcgagtccgatcatccgggcctcatcgtgtcg
agcatgagcaagatcgtgcgcggcggccgggtgctcatcgactggagccagaacaacggc
aagaagacgacgatcgccccgtactcgctgcgcgggcgggcccgcccgacggtggccgcg
ccgcgcacgtgggaggagctcgacgaccccggcctgcggcacctcgaggcgcacgaggtg
ctcgagcgcgtggcatccggaatcgacccgatcgcctcgctcgcggactcgggcgggggc
gccgggggcggcgccgggccgctcgcgacgtacctctcgatgcgcacgaccggcgtcacg
cccgagccgatgccggggtcgagttgggcggcgcccggcgggggagccccgggttcgagc
gcgctgtcgttcgtgatccaggagcaccacgcgaggcgactgcactacgacttccggctc
gagcgcgacggcgtgctgaagagctgggcggtgcccaagggcgtgccggaggatccgggc
gtgaaccacctcgcggtgcagaccgaggaccaccccctggagtacggcgggttcgagggc
acgatccccggcggcgagtacggtgccgggtcggtgacgatctgggatgcgggcacctac
gcgaccgagaagtggcgcgacgacgaggtcatcgtcgacgtgcagggccgggtcggcgga
ccgctcggcgccgtgcggctcgcgctgatccgcacgggcggcgagggcgagaagagcacg
tggctgctgcaccgcatgaaggaccagcggccgggggaggtcgttgcgacggtcgggtct
cgagacggcgccggcgcgcctcctcgaccggcggccggcgcgaaccccgccggtcgagga
gggagcgaagcgagcgtctcgagaccagcgactccgggagcggccgagccgatcaccgcg
cgccccatgctcgcgtcgcccggcacgctcggcctcgtcggcgccggcgactgggcgctc
gagtacaagtgggacggcatccgcgtgctcgcgcgcaccgacggcgggggcctgcgcctg
gtcagccgcaacggcaacgacgtcacctccagataccccgagctcgccggcctgcccggc
gccctccgcggtgatgcgctcgtcgacggcgagctcgtcgcgctcgacgacgacggccgc
ccgagcttcgagctgctgcagtcgcgcatgaacctcacgcgcaccagggagatacagcgg
ctcgcgacatccgcccccgttcgcctgctgctcttcgacgtgctcgagatcgcgggcgac
gacgtgacggatgccccctaccgcgagcggcgtcgccggctcgagcggctcgtgcggccc
gggtcgggcatgcccgtggaggtgcccgccctggcgaccggatcgcccgccgacgcgctc
gccgaagcgcgccggctcggcctcgaggggctcgtggcgaagcggcccgactcgacgtac
caccccggaacacgttccgagcagtggctgaagctcaagctcacgcgcacgcaggaggtc
gtgatcggcggctaccgcgtcggcgtcggttcgcgaaccggccgcatccgctcgctgctc
gtcgggatcccgggcgagcacggactcgagtacgccggtcgcgtcggcagcggcctgcgc
gagctggagtccgagcgcctgctcgcgcgactcgacgccgccgtgcgggagacatcgccg
ttcgtcgacgtgcccgaggcggatgccgtcgatgcggtctgggtcgagccgcagctcgtc
ggcgagatcgagctcgccgagtggacgagcacgggcgtggcgcgccatccgcgctggcgg
gggctcaggcccgacaagtcgccgagcgaggtcgtgcgcgaggcgtga

DBGET integrated database retrieval system