KEGG   Agromyces aureus: ATC03_01695Help
Entry
ATC03_01695       CDS       T04413                                 

Definition
(GenBank) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
agy  Agromyces aureus
Pathway
agy00500  Starch and sucrose metabolism
agy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ATC03_01695
Enzymes [BR:agy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ATC03_01695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_25 Alpha-amylase CBM53
Motif
Other DBs
NCBI-ProteinID: ANJ28621
UniProt: A0A191WK41
LinkDB All DBs
Position
complement(392242..394302)
Genome map
AA seq 686 aa AA seqDB search
MRYLASAALIALIGTLISATAVAAPANAAAPGPKDTTAVLFSWTWNAIARECTENLGPAG
YGFVQTSPPQEHVQGPEWWTYYQPVSYKIESRLGTRAEFKAMVDTCHTAGVKVIADAVIN
HMSGKSGGGTGWAGSSFQHYDYPGIYSSQDFHSCRRDISNYQNRTEVQECNLVNLSDLNT
SSSYVQGKIAGYLNDLVSLGVDGFRIDAVKHIAASDMQGILSKVNDRARLYIVQEVIRAN
EPIQPEEYTSYGDIHEFAFARKLKEAFGGGTINWLVTGNGIGPSWAGFLPNQNAAVFVDN
HDTERNGETLSYKDGAGYDLAQIFTLAWNYGSPSIHSGYQFSNKEAGPALAGNGEVIDPV
CGQNGWTCKHAQTNIENMVGFRNTTYGTAVTNTWSNGSSAIAFGRGDKGYVAINRGGSLT
RTFQTSLPAGGYCNVTVGLPTTSGCTAGGIVTVNAAGQFTATVDANQAIALHVGAKAGQG
GTDPGTDPGTNPGTGDLTVYYSTSKGWTGYNVHYRVGAGAWTTAPGVGLTAACSGWVSKT
ITGGASGITAAFNNGSGTWDNNGGRDYALSGAVATVNGGVVGSTNPCGTTQPATTATVYY
ATGWASTNVHYRVGSGAWTTAPGVAMADACTGWKVKTIDLGGSTGLTAAFNNGSGTWDNN
GGKDYAIGAGTVKVSNGTVTAGNPCS
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatatcttgcaagcgcagcactcatcgccctcatcggcaccctcatctcggccacc
gccgtcgcggcaccggccaacgctgcagcgccgggcccgaaggacacgaccgcggtcctg
ttctcgtggacctggaatgcgatcgcgcgcgagtgcaccgagaacctgggcccggcgggg
tacgggttcgtgcagacctcccctccgcaggagcacgtgcagggtccggagtggtggacc
tactaccagcccgtcagctacaagatcgagtcccggctcggcacccgggccgagttcaag
gccatggtcgacacctgccacaccgccggagtgaaggtcatcgcggatgccgtgatcaac
cacatgtcgggcaagagcggcggcggtaccggttgggcgggttcgtcgttccagcactac
gactacccgggcatctactcctcgcaggacttccactcctgccggcgcgacatctcgaac
tatcagaaccgcaccgaggtgcaggagtgcaacctcgtgaacctctccgacctgaacacg
tcctcgtcgtacgtgcagggcaagatcgccgggtacctgaatgacctcgtctcgctcggg
gtcgacgggttccgcatcgacgccgtcaagcacatcgccgccagcgacatgcagggcatc
ctgtccaaggtcaacgaccgcgcccggctgtacatcgtgcaggaggtgatccgcgccaac
gaacccatccagcccgaggagtacacgtcgtacggcgacatccacgagttcgcgttcgcc
cgcaagctcaaggaggccttcggcggcggcaccatcaactggctcgtcacgggcaacggc
atcgggccgtcatgggccggcttcctgcccaaccagaacgccgccgtgttcgtcgacaac
cacgacaccgaacgcaacggcgagaccctgtcctacaaggacggcgccggctacgacctc
gcgcagatcttcaccctcgcctggaactacggctcaccctcgatccactccggctaccag
ttctcgaacaaggaagccgggccggcactcgccggcaacggcgaggtcatcgaccccgtc
tgcggacagaacggctggacctgcaagcacgcccagacgaacatcgagaacatggtcggg
ttccgcaacaccacgtacggcaccgccgtcacgaacacctggtccaacgggtcgtcggcc
atcgccttcggccgcggcgacaagggctacgtcgcgatcaaccgcgggggctcgctcacg
cgcacgttccagacctcgctccccgcgggcggctactgcaacgtgaccgtcggcctgccc
accacgagcggatgcaccgccggaggcatcgtgaccgtgaacgccgcgggccagttcacc
gcgaccgtcgatgccaaccaggccatcgccctccacgtcggagcgaaggccgggcagggc
ggtaccgaccccggcacggatccgggaacgaacccgggaaccggcgacctgacggtctac
tactcgacctcgaaggggtggaccggatacaacgtgcactaccgcgtcggggcgggcgcc
tggaccaccgcgcccggagtcgggctgaccgccgcctgctcgggctgggtgtcgaagacc
atcaccggcggcgcctcgggcatcaccgccgcgttcaacaacgggtccggcacgtgggac
aacaacggcgggcgcgactacgcgctctccggagcggtcgccacggtgaacggcggcgtc
gtcggctcgacgaacccgtgcggcacgacgcaaccggccacgacggcgaccgtctactac
gcgacgggatgggcgagcacgaacgtccactaccgggtcggctcgggcgcctggaccacc
gcgcccggtgtcgccatggcggacgcctgcaccggatggaaggtcaagacgatcgacctc
ggcggctcgaccggcctcaccgcggccttcaacaacgggtcgggcacgtgggacaacaac
ggcggcaaggactacgcgatcggcgccggaacggtgaaggtgtcgaacggcaccgtcacc
gcgggcaacccgtgtagctga

DBGET integrated database retrieval system