KEGG   Agromyces aureus: ATC03_03735Help
Entry
ATC03_03735       CDS       T04413                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
agy  Agromyces aureus
Pathway
agy00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:agy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ATC03_03735
Enzymes [BR:agy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ATC03_03735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_14 Glyco_hydro_2_C Glyco_hydro_42C Glyco_hydro_35 AvrLm4-7
Motif
Other DBs
NCBI-ProteinID: ANJ25976
UniProt: A0A191WCI7
LinkDB All DBs
Position
894013..896061
Genome map
AA seq 682 aa AA seqDB search
MTIWYGGDYNPEQWPRPVWDEDVQLMNRAGVSLATVGVFSWARLEPRPGEYDFAWLDEVL
DLLHAGGVRVDLATATASPPPWLAARHPETLPVTEDGVRLSVGSRQQYCPSSPEYRERAG
ELVRRLVERYADHPALELWHINNEYGCHVSRCYCDVSAEAFREWLRERYGTVDELNRAWG
TAFWSQHYDAFDEVQPPRAAPTFRNPTHLLDFERFSSDELLACFRAEKAIIRAGSSVPVT
TNFMGFFKPVDYWSWAAEVDVVSDDTYPDPADPGSPAYAAMVRDLMRSLGGGAPWLLMEQ
SPSAVNWRAQNAAKAPGQMRAWSYQSVARGADGILFFQWRQSAAGSEKFHSGLVPHSGTD
TRVWREVEQLGGELAMLSARSGDEAIAGTRVASRVAIALDWHSWWAIEQPASPTEVSYLR
ALGAWHAALTSLGLVVDFVRAEGDLSGYDLVVAPAHLVATDAQVSNLAAFAETGTLIVGF
GTAVLDEHLHVRLGGYLGEPLRRALGVWIEEFAPPAAPDLANAGGKAAPPLALAGDVVGG
SAFGTAWGEYVRVEDAETLATFDDGALRGWPAVTRRRTGTGSGSGSGSGSAWYVATLPDP
ESLRLIAESAAREAGIELPPAATRGGQVEAVRRGSALFVINHGPDEAELLVDGTDLLSGA
QAQGLRLASQGVAIVVAEANPE
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctggtacggcggggactacaaccccgaacaatggccgcgtcccgtctgggac
gaggacgtgcagctcatgaaccgggcgggcgtctcgctcgcgacggtcggcgtgttctcg
tgggcgcggctcgaaccgcgcccgggggagtacgacttcgcatggctcgacgaggtgctc
gacctgctgcacgcgggcggggtgcgggtcgacctcgcgaccgcgacggcgtcgccgccg
ccatggctggccgcgcggcatccggagaccctgcccgtgaccgaagacggcgtgaggctc
tcggtcggcagtcggcagcagtactgcccgagctcgcccgagtaccgcgagcgggcgggc
gagctcgtgcgccgcctggtcgagcggtacgccgaccacccggcgctcgagctgtggcac
atcaacaacgagtacggatgccacgtcagccggtgctactgcgacgtgtcggccgaggcc
ttccgcgagtggttgcgcgagcggtacggcacggtcgacgagctgaaccgtgcgtggggc
acggcgttctggtcgcagcactacgacgcgttcgacgaggtgcagccgccgcgggcggcg
ccgacgttccggaaccccacgcacctgctcgacttcgaacggttctcgagcgacgagctg
ctcgcctgcttccgggccgagaaggcgatcatccgcgcggggtcgtcggtgcccgtcacg
acgaacttcatggggttcttcaagcccgtcgactactggtcgtgggcggccgaggtcgac
gtcgtgagcgacgacacctaccccgatccggcggatcccggctcgcccgcctacgccgcg
atggtgcgcgacctcatgcgctcactcggcggcggggcgccctggctgctcatggagcag
tcgcccagcgcggtgaactggcgggcgcagaacgccgcgaaggcgccgggccagatgcgg
gcgtggtcgtaccaatcggtggcgcgcggggccgacggcatcctgttcttccagtggcgg
cagtcggccgcggggtcggagaagttccactccggtctcgtgccgcactcgggcaccgac
acgcgcgtctggcgcgaggtcgagcagctcggcggcgaactcgcgatgctctccgctcgg
agcggcgacgaggcgatcgcgggcaccagggtcgcgtcgcgcgtggccatcgcgctcgac
tggcacagctggtgggcgatcgagcagccggcatcgccgaccgaggtctcgtacctgcgc
gcgctcggcgcctggcacgccgcgctcacctcgctcggtctcgtcgtggacttcgtgcgc
gccgagggcgacctgtcgggctacgacctcgtcgtggctccggctcacctcgtcgccacc
gacgcccaggtgtcgaacctcgcggccttcgccgagaccggcacgctcatcgtcggattc
ggcaccgcggtgctcgacgagcacctgcacgtgcggctcggcggctacctcggcgagccg
ttgcgccgtgccctcggggtgtggatcgaggagttcgcgccaccggcggcgcccgacctg
gcgaatgcgggcggcaaggcggccccgccgctcgcgctcgcgggcgacgtcgtcggcggg
tccgcgttcggcacggcgtggggcgagtacgtgcgcgtcgaggatgccgagacgctcgcg
accttcgacgacggcgccttgcgcgggtggccggcggtcacccggaggcgcaccggcacc
ggcagcggcagtggcagcggcagcggcagcgcttggtacgtcgcgaccctgcccgacccc
gagtcgctgcgcctgatcgccgagtcggcggcccgcgaggccggcatcgagctgccgccg
gcggcgacccgcggcggccaggtcgaggccgtgcgacgcggatcggcgctgttcgtcatc
aaccacgggcccgacgaggccgaactgctcgtcgacggcaccgacctgctctcgggggcg
caggcgcagggtctgcgtctcgcgtcgcagggcgtcgcgatcgtcgtggccgaggcgaac
cccgagtag

DBGET integrated database retrieval system