KEGG   Agromyces aureus: ATC03_05910Help
Entry
ATC03_05910       CDS       T04413                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
agy  Agromyces aureus
Pathway
agy00020  Citrate cycle (TCA cycle)
agy00480  Glutathione metabolism
agy01100  Metabolic pathways
agy01110  Biosynthesis of secondary metabolites
agy01120  Microbial metabolism in diverse environments
agy01130  Biosynthesis of antibiotics
agy01200  Carbon metabolism
agy01210  2-Oxocarboxylic acid metabolism
agy01230  Biosynthesis of amino acids
Module
agy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
agy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:agy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ATC03_05910
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ATC03_05910
Enzymes [BR:agy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ATC03_05910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP ART-PolyVal
Motif
Other DBs
NCBI-ProteinID: ANJ26320
UniProt: A0A191WDH2
LinkDB All DBs
Position
1397134..1398351
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQAIKDQLIHPYLDVNLEYYDLSIQKRDETDDQITVDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIIISNIPRL
VPGWNKPIIVGRHAFGDQYRATDFRFEGEGTLTMTFTPKDGSEPQQFEVFQSPGSGVAMG
MYNLDESIRDFARASLNYGLSRNYPVYLSTKNTILKAYDGRFKDLFQEVFEAEFKEAFDA
AGLTYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLATPDGR
VVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLAHRGKLDGNQELIDFSLTLED
VVIKTVESGAMTKDLAALVGPEQAYQTTEEFLQTLSDNLKARIAA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaagatcaaggttgaaggcaccgtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcaggccatcaaggaccagctcatccacccgtacctcgacgtgaacctcgag
tactacgacctctcgatccagaagcgcgacgagaccgacgaccagatcacggtcgacgcg
gcccacgcgatccagaagcacggcgtcggcgtcaagtgcgcgacgatcacgcccgacgag
gcgcgcgttgaggagttcggcctgaagaagatgtggcgttcgccgaacggcacgatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcatcatctcgaacatcccgcgcctg
gtgccgggctggaacaagccgatcatcgtcggccgccacgcgttcggcgaccagtaccgc
gccaccgacttccgcttcgagggcgagggcacgctcacgatgaccttcaccccgaaggac
ggctccgagccgcagcagttcgaggtcttccagtcgcccggttcgggcgtcgccatgggc
atgtacaacctcgacgagtcgatccgcgacttcgcgcgagcctcgctcaactacggtctc
tcgcgcaactacccggtgtacctctccaccaagaacaccatcctcaaggcctacgacggc
cgcttcaaggacctcttccaggaggtcttcgaggccgagttcaaggaggcgttcgacgcc
gccggcctcacctacgagcaccgcctcatcgacgacatggtcgcggcatcgctcaagtgg
gagggcggctacgtctgggcgtgcaagaactacgacggcgacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggcctgatgacctcggtcctggccacgcccgacggccgg
gtcgtcgaggccgaggcggcgcacggcaccgtcacgcgccactaccgccagcaccagcag
ggcaagcccacgtcgaccaacccgatcgcctcgatctacgcctggacgcgcggcctcgcg
caccgcggcaagctcgacggcaaccaggagctcatcgacttctcgctcaccctcgaagac
gtcgtcatcaagacggtcgagtcgggcgccatgacgaaggacctcgcagccctcgtcggc
cccgagcaggcctaccagacgaccgaggagttcctgcagaccctctccgacaacctgaag
gcgcgcatcgcggcctag

DBGET integrated database retrieval system