KEGG   Agromyces aureus: ATC03_06410Help
Entry
ATC03_06410       CDS       T04413                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
agy  Agromyces aureus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ANJ26407
UniProt: A0A191WDV8
LinkDB All DBs
Position
1504097..1505158
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVSPMLSKAVKEIPDVGHVEPKWDGFRTIVFRDGDEIELGSRNEKPMTRYFPE
LVEALRANLPERCVVDGEIILVRDGRLDFDALQQRIHPAASRVKLLSEQTPVSFVAFDLL
ALGDDGLMARPFGERRALLETALAAASDPVFVTPATADLAEAREWFTRYEGAGLDGVVAK
PLDGAYLPDKRTMFKVKHERTADCVVAGFRWHKTGDIVGSLLLGLYDGEGRLHHVGVAAS
FSMARRAQLVEELAPYVEEDLSRHPWGEWAAQDGQGSRMPGAVSRWSAGKNLSFVPLRPE
LVVEVGYSQMEGDRIRHTAQFKRWRLDRDAASCTYEQLESPDGLDLSQILPVR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccggtgatgcctcctgtctcgcccatgctgtcgaaggcggtcaaggagatc
cccgacgtggggcacgtcgaaccgaagtgggacggcttccgcacgatcgtgttccgcgac
ggcgacgagatcgagctcggcagccgcaacgagaagcccatgacgcggtacttccccgaa
ctcgtcgaggcgttgcgcgccaacctgcccgagcggtgcgtcgtcgacggcgagatcatc
ctcgtgcgcgacggccgcctcgacttcgacgcgctgcagcagcggatccacccggccgca
tcgcgggtgaagctgctctcggagcagacgccggtctcgttcgtggcgttcgacctgctg
gcgctcggcgatgacggcctgatggcgaggcccttcggcgagcgacgcgcactgctcgag
accgcgctcgccgcggcatccgaccccgtgttcgtgacccccgcgaccgccgacctcgcc
gaggcgcgcgagtggttcacgcggtacgagggggcagggctcgacggcgtggtcgcgaag
ccgctcgacggcgcctacctgcccgacaagcgcacgatgttcaaggtcaagcacgagcgc
acggccgactgcgtggtggccgggttccgctggcacaagacgggcgacatcgtgggctcc
ctgctgctcggcctctacgacggcgagggccggctgcaccacgtcggtgtcgcggcctcg
ttctcgatggcgcgccgcgcccagctcgtcgaggagctcgcgccgtacgtcgaagaggac
ctgtcgcggcatccgtggggcgaatgggccgcgcaggacgggcagggcagccggatgccg
ggcgcggtgagtcggtggtcggcgggcaagaacctctcgttcgtgccgttgcgccccgaa
ctcgtggtcgaggtcggctacagccagatggagggcgatcgcatccgccacacggcgcag
ttcaagcggtggcgcctcgatcgggatgccgcgtcgtgcacgtacgagcagctcgagtcg
cccgacgggctcgacctgtcgcagatcctgcccgtgcgctga

DBGET integrated database retrieval system