KEGG   Agromyces aureus: ATC03_10660Help
Entry
ATC03_10660       CDS       T04413                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
agy  Agromyces aureus
Pathway
agy00020  Citrate cycle (TCA cycle)
agy00190  Oxidative phosphorylation
agy00650  Butanoate metabolism
agy01100  Metabolic pathways
agy01110  Biosynthesis of secondary metabolites
agy01120  Microbial metabolism in diverse environments
agy01130  Biosynthesis of antibiotics
agy01200  Carbon metabolism
Module
agy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
agy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
agy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:agy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ATC03_10660
   00650 Butanoate metabolism
    ATC03_10660
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ATC03_10660
Enzymes [BR:agy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ATC03_10660
    1.3.5.4  fumarate reductase (quinol)
     ATC03_10660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 DAO Pyr_redox_2 HI0933_like NAD_binding_8 Pyr_redox_3 GIDA
Motif
Other DBs
NCBI-ProteinID: ANJ28851
UniProt: A0A191WKU3
LinkDB All DBs
Position
2399077..2400780
Genome map
AA seq 567 aa AA seqDB search
MLVIGTGGSGLRAAIELAEAGVDVLALGKRPKSDAHTSLAAGGINAALATIDADDSWQQH
AADTLKESYLLADPRTVVTVTEGAARGIDDLERYGMPFAREDDGRISQRFFGAHTYRRTA
FAGDYTGLEIQRTLINRAAQLRVPILDTVYITRILVNDDGAVFGAYGFDVEDGTRYLIHA
DAVILAAGGHNRIWRRTSSRRDENTGDSWRLAVEAGGRVRDPELVQFHPSGIIEPENAAG
TLISEAARGEGGILTNGLGERFMHKYDPERLELSTRDRVALACYTEIKEGRGTPNGGVWL
DVSHLPRETIMQRLPRVYQTMLELQMLDITKEPIEIAPTAHYSMGGVWVRPEDHGTDVPG
LYAIGEASSGLHGANRLGGNSLIELLVFGRIVGQAAIDYSRSLTAQTRSGAAVRTARDEI
STLLAGDGTENVRALQRAIRNTMTEHAGVVRDEQGLLAGLAELDAIEARIAEVGVHPDIA
GYQDLAHAFDLKSAALAARATLEAALERRETRGCHNRSDFPETDAALQVNLVWSPSAGVT
REAIPPIPAEIAALMREEVSVAGKLVE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgtcatcggcaccggcggatccggcctgcgcgccgccatcgaactcgcggaggcg
ggcgtcgacgtgctcgccctcggcaagcggcccaagtccgacgcgcacacctcgctcgca
gccggcggcatcaacgccgccctcgccacgatcgacgccgacgacagctggcagcagcac
gccgccgacacgctgaaggagagttacctgctcgccgacccgcgcaccgtcgtcaccgtc
accgagggcgcggcgcgcggcatcgacgacctcgagcgctacggcatgcccttcgcccgt
gaagacgacggccgcatctcgcagcgcttcttcggcgcgcacacctaccggcgcacggcg
ttcgccggcgactacacgggcctcgagatccagcgcacgctcatcaaccgggccgcgcag
ctgcgcgtgccgatcctcgacacggtctacatcacgcgcatcctcgtgaacgacgacggc
gcggtgttcggcgcctacggcttcgacgtcgaggacggcacgcgctacctcatccacgcc
gacgcggtcatcctcgccgcgggcggccacaaccgcatctggcggcgcacctcgtcgcga
cgcgacgagaacaccggtgattcctggcgcctggccgtcgaggcgggtgggcgggtgcgc
gaccccgaactcgtgcagttccacccctcgggcatcatcgaacccgagaacgcggccggc
acgctcatctccgaagcggcccgcggcgagggcggcatcctcaccaacggcctcggcgag
cgtttcatgcacaagtacgaccccgagcggctcgagctctcgacccgcgaccgcgtcgcc
ctcgcctgctacaccgagatcaaggaaggtcgcggaacccccaacggcggagtctggctg
gatgtctcgcacctgccccgcgagacgatcatgcagcgacttccccgcgtataccagacc
atgctcgagctgcagatgctcgacatcacgaaggagccgatcgagatcgcgccgaccgcg
cactactcgatgggcggcgtctgggtgcgcccggaggaccacggcaccgacgtgcccggc
ctctatgcgatcggtgaggcgtcgtcgggcctgcacggcgcgaaccgcctcggcgggaac
tcgctgatcgagctgctggtcttcgggcgcatcgtcggccaggctgcgatcgactattcg
cgctcgctcaccgcgcagacgcgatcgggcgccgcggtgcggaccgcgcgagacgagatc
tcgacgctgctcgccggcgacggcaccgagaacgtgcgggccctgcaacgcgccatccgc
aacaccatgaccgagcacgccggcgtcgtccgcgacgagcagggcctgctggccggcctc
gccgagctcgacgcgatcgaggcgcgcattgcggaggtcggtgtgcaccccgacatcgcc
ggctaccaggacctggcgcacgccttcgacctcaagtccgccgcgctcgccgcccgcgcc
accctcgaggccgcactcgagcgccgcgagacccgcggctgccacaaccgcagcgacttc
cccgagacggatgccgcgctccaggtgaacctcgtctggtcgccgtccgccggggtcacc
cgcgaggcgatcccgccgatccccgccgagatcgcggccctcatgcgcgaggaggtctcg
gtggcgggcaagctcgtcgagtag

DBGET integrated database retrieval system