KEGG   Agromyces aureus: ATC03_13170Help
Entry
ATC03_13170       CDS       T04413                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
agy  Agromyces aureus
Pathway
agy00010  Glycolysis / Gluconeogenesis
agy00030  Pentose phosphate pathway
agy00051  Fructose and mannose metabolism
agy00052  Galactose metabolism
agy00680  Methane metabolism
agy01100  Metabolic pathways
agy01110  Biosynthesis of secondary metabolites
agy01120  Microbial metabolism in diverse environments
agy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:agy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATC03_13170
   00030 Pentose phosphate pathway
    ATC03_13170
   00051 Fructose and mannose metabolism
    ATC03_13170
   00052 Galactose metabolism
    ATC03_13170
  09102 Energy metabolism
   00680 Methane metabolism
    ATC03_13170
Enzymes [BR:agy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ATC03_13170
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     ATC03_13170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ANJ27520
UniProt: A0A191WGU9
LinkDB All DBs
Position
complement(2929269..2930300)
Genome map
AA seq 343 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGMVLKGVISYDTEFVGFRNGWRGVVEEDLMPIVRHDVRGL
AKQGGTILGSSRTNPFEGEGGGPEKIQAMLDRNGIDAIVAIGGEGTLTAARRLYDEGGIK
VIGVPKTIDNDLAATDYSFGFDTAVQIATEAIDRLRTTADSHGRCMVLEVMGRHVGWIAL
HSGMAGGAHAILIPEQPQTIEQITEWVESVRDRGRAPLVVVAEGFKFEGMEEAHSHKGLD
AFNRPRLGGIAELLAPMIEERTGIESRATVLGHIQRGGEPTAFDRVLATRLGMAAVDAAY
NDAWGSMVTLRGTSIATVSIADAVGTLNQVPQARYDEAKILFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggaatcctcacctcgggcggcgactgccccggtctgaacgcggtcatccgc
ggcatggtgctgaagggcgtcatctcgtacgacaccgagttcgtcggcttccgcaacggc
tggcgcggcgtcgtcgaagaagacctcatgcccatcgtgcgccacgacgtgcgaggcctc
gccaagcagggcggcacgatcctcggctccagccgcaccaacccgttcgagggcgagggc
ggcgggcccgagaagatccaggccatgctcgaccgcaacggcatcgacgcgatcgtcgcg
atcggcggcgagggcacgctcaccgcggcccgccgcctctacgacgagggcggcatcaag
gtcatcggcgtgccgaagaccatcgacaacgacctcgcggccaccgactactcgttcggc
ttcgacaccgcggtgcagatcgcgaccgaggcgatcgaccgcctgcgcacgacggccgac
tcgcacggccgctgcatggtgctcgaggtcatgggccgacacgtcggctggatcgccctg
cactccggcatggccggcggcgcgcacgcgatcctcatccccgagcagccgcagaccatc
gagcagatcaccgagtgggtcgagtcggtgcgcgaccgcggccgtgcgccgctcgtcgtc
gtcgccgagggcttcaagttcgagggcatggaggaggcgcactcgcataagggcctcgac
gccttcaaccgcccgcgtctcggcggcatcgccgaactcctcgcgcccatgatcgaggag
cgcacgggcatcgagtcgcgtgcgaccgtgctcggccacatccagcgcggtggcgagccg
accgccttcgaccgcgtgctcgccacgcgtctcggcatggccgccgtcgacgcggcgtac
aacgacgcctgggggtcgatggtcacgctgcgcggaaccagcatcgcgaccgtctcgatc
gccgacgccgtcggcacgctcaaccaggtgccccaggcccgctacgacgaggcgaagatc
ctcttcggctga

DBGET integrated database retrieval system