KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0596
Entry
AHA_0596          CDS       T00424                                 

Gene name
argG
Definition
(RefSeq) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00220  Arginine biosynthesis
aha00250  Alanine, aspartate and glutamate metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01230  Biosynthesis of amino acids
Module
aha_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_0596 (argG)
   00220 Arginine biosynthesis
    AHA_0596 (argG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aha04147]
    AHA_0596 (argG)
Enzymes [BR:aha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     AHA_0596 (argG)
Exosome [BR:aha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AHA_0596 (argG)
SSDB
Motif
Pfam: Arginosuc_synth
Other DBs
NCBI-GeneID: 4489263
NCBI-ProteinID: YP_855129
UniProt: A0KFV3
LinkDB
Position
634039..635274
AA seq 411 aa
MSGINKIVLAYSGGLDTSAIIPWLKENYDAEIIAFVADVGQERDDLEGIEQKAIASGATK
CIVKDLREEFVKEYVYPTLKTGAVYEGTYLLGTSMARPVIAKAMVEAALAEGADAISHGC
TGKGNDQVRFEGAVAALAPQLKVIAPWRLWDMRSREDLLAYLETRNIPCKATLKKIYSRD
ANAWHISTEGGELESTWNEPSEAVWQWTVPAEQAPDQPEYVKLTVAQGEVVAVDDQPLSP
HQILTTLNERAGKHGVGRIDITENRMVGMKSRGCYETPGGTVMVAALRAVEELVLDRPTR
AWREKLGAEFSHLVYDGRWFTPLCKAIVASANAIAEDLDGEVVLKMYKGQVTAVQKKSPN
SLYSEDFATFGADEVYDQSHAEGFIRLYTLASRIRAMKEQHQAIGGDHTHG
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgagcggaatcaacaagatcgtactggcttactcgggcggactggatacctcggccatc
attccctggctgaaggaaaactatgatgcggagatcatcgccttcgtcgccgatgtcggt
caggagcgtgacgatctggaagggatcgagcaaaaagccatcgcctccggcgccaccaag
tgcatcgtcaaggatctgcgggaagagttcgtcaaagagtacgtctacccgaccctgaag
accggcgccgtctatgagggcacctacctgctgggtacctccatggcccgtccggtgatc
gccaaggcgatggtcgaggcggcgctggcggaaggggccgatgccatctcccacggttgc
accggcaagggcaacgatcaggtgcgtttcgaaggtgcagtcgccgcgctggcgccccag
ctgaaagtgatcgccccctggcgtctgtgggacatgcgctcccgggaagatctgctggcc
tacctggagacccgcaacatcccctgcaaggcgaccctgaagaagatctacagccgcgac
gccaacgcctggcacatctccaccgagggtggcgagctggagagtacctggaacgagccg
tccgaagcggtctggcagtggaccgtaccggccgagcaggcaccggatcagccggagtac
gtcaagctgaccgtggctcagggtgaagtggtggccgttgacgaccagccgctcagtccg
caccagatcctgaccaccctgaacgagcgtgccggcaagcacggcgtgggccgcatcgac
atcaccgaaaaccggatggtgggcatgaagtcccgtggctgttacgagaccccgggcggt
accgtgatggtcgccgcactgcgcgccgtggaagagctggtcttggatcgcccgacccgc
gcctggcgggaaaagctgggtgccgagttctcccacctggtctatgacggtcgctggttc
accccgctgtgcaaggccattgtcgcctctgccaacgccatcgccgaagatctcgacggt
gaagtggtgctgaaaatgtacaagggtcaggtcaccgcggtgcagaagaagtcgccgaac
agcctctactccgaagacttcgccaccttcggcgccgacgaagtgtacgaccagagtcat
gccgaaggctttatccgtctctacaccctggcgagccggatccgcgccatgaaggagcag
catcaggccatcggtggcgatcacactcacggctaa

DBGET integrated database retrieval system