KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0776
Entry
AHA_0776          CDS       T00424                                 

Definition
(RefSeq) bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00250  Alanine, aspartate and glutamate metabolism
aha00330  Arginine and proline metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_0776
   00330 Arginine and proline metabolism
    AHA_0776
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aha03000]
    AHA_0776
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     AHA_0776
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     AHA_0776
Transcription factors [BR:aha03000]
 Prokaryotic type
  Ribbon-helix-helix
   Other families
    AHA_0776
SSDB
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Other DBs
NCBI-GeneID: 4487936
NCBI-ProteinID: YP_855318
UniProt: A0KGC8
LinkDB
Position
832876..836040
AA seq 1054 aa
MFKATQVLAADYVPSDLAALREAITQNYVVDENAYLAELSAMLPGDGASLERVTQRARTL
VTKVRKESGSGDGIDAFLQEYSLDTQEGIILMCLAEALLRIPDAETADALIKDKLSGANW
SSHFRKSDSTLVNASTWGLMLTGKIIKLDKKLDGNPANLLGRMVNKLGEPVVRSAMYAAM
KIMGKQFVLGRDMKEALKASRKSREKGYTHTYDMLGESALTLADADKYFGDYQRAIEAVG
NERISDGGPAPSISIKLSALHPRYDVANRERVLGEMCERLVGLVRLARDKDVAISIDAEE
MDRLELSLDLFEQLYRSDANRGWGKLGMVVQAYSKRALPVLCWLTALAREQGDLIPVRLV
KGAYWDSELKYAQQAGLPGYPLFTRKAGTDISYLACARYLLSEPTRGFISPQFATHNANT
VVSILEMAGDRQFEFQRLHGMGEELHNAVLSEYPGLHCRIYAPVGAHKDLLPYLVRRLLE
NGANTSFVHKLVDPNTPVDSLAEHPLRTLKRYSSLANDRIPQPVNLFSDRKNSSGVNMNI
LSIQRPFFAKLKEVESKQWLAGPIVDGETLKRNEARVVLSPQDVSLTVGKIHWADEQAVE
QALASAHAAFPRWRETPVSERAAALEKLADLLEANREQFISLCTREAGKLLQDGIDEVRE
AVDFCRYYAVQARGLMGQATLLPGYTGEMNELFLQGRGVFVCISPWNFPLAIFLGQVAAA
LATGNTVIAKPAEQTGLIAHLAVTLAHQAGIPGDVLQLLPGDGATVGAKLTADARIGGVC
FTGSTETAKLINMTLAQRDGAILPLIAETGGQNAMIVDSTALPEQVVRDVVSAAFQSAGQ
RCSALRVLYLQEEIAPRVLEILTGALQELKVGNPAEHNTDVGPVIDAEAKAGLDAHLVHM
IPRARLIAQAPMPAVTLGGHFVQPTALEIGSIRELTREQFGPILHVVRYAARDLDKVISD
INGTGYGLTLGIHSRNESHAEELASRINVGNVYINRNQIGAMVGVQPFGGQGLSGTGPKA
GGPHYLSRFITEKTRTINTTAVGGNASLLAMGDA
NT seq 3165 nt   +upstreamnt  +downstreamnt
atgttcaaagctacccaagtgcttgccgctgactatgttccctccgatctggccgccctg
cgcgaagccatcacccagaactacgtggtggatgaaaatgcctatctggccgagctgtcg
gccatgctgccgggggatggcgcctcgctggaacgggtgacccagcgtgcccgcaccctg
gtgaccaaggtgcgcaaggagagcggctccggcgacggcatcgacgccttcttgcaagag
tacagcctggatacccaggaggggatcatcctgatgtgcctggcggaggcgctgctgcgc
attcccgatgccgagaccgccgatgccctgatcaaggacaagctctccggcgccaactgg
tcgtcccattttcgcaaaagcgactccaccctggtgaacgcctccacctgggggctgatg
ctgaccggcaagatcatcaagctggacaagaagctggacggcaacccggccaacctgctg
ggccgcatggtcaacaagctgggggagccggtggtgcgctccgccatgtacgccgccatg
aagatcatgggcaagcagttcgtgctggggcgcgacatgaaagaagccctcaaggcgagc
cgcaagtcccgcgagaagggttacacccacacctacgacatgctgggggagtccgccctg
accctggccgatgccgacaagtatttcggtgactaccagcgcgccatcgaggcggtgggc
aacgagcgcatcagcgacggcggcccggccccttccatctccatcaagctgtcggcgctg
catccgcgctatgacgtggccaaccgcgagcgggtgctcggcgaaatgtgcgagcggctg
gtgggactggtgcgcctcgcccgcgacaaggacgtggctatcagcatcgatgccgaagag
atggaccgcctcgagctctccctcgatctgttcgagcagctctatcgctccgacgccaac
cgcggctggggcaagctcggcatggtggtgcaggcctactccaagcgcgccctgccggtg
ctctgctggctcaccgcgctggctcgcgagcagggggacctgatcccggtgcggctggtg
aagggcgcctactgggacagcgagctcaaatatgcccagcaggccggcctgcccggctac
ccgctgtttacccgcaaggcgggcaccgacatctcctacctcgcctgcgcccgctacctg
ctgagcgagccgacccgcggctttatctcgccccagtttgccacccacaacgccaacacc
gtggtcagcattctggagatggctggcgatcgccagttcgagttccagcgcctgcacggc
atgggggaggagctgcacaacgccgtgctcagcgaatatcccggcctgcactgccgcatc
tatgcgcctgtgggtgcccacaaggatctgctgccctacctggtgcgccgtctgctggag
aacggggccaacacctccttcgtccacaagctggtggatcccaacaccccggtcgactcc
ctggccgagcacccgctgcgcaccctcaagcgttactccagcctggccaacgatcgcatt
ccgcagccggtgaacctgttcagcgaccgcaagaactccagcggagtcaacatgaacatc
ctctccatccagcgccccttcttcgccaagctgaaggaggtggagagcaagcagtggttg
gcgggtcccatcgtcgatggcgagaccctcaagcgcaatgaggcccgtgtggtgctgagc
ccgcaggatgtgagcctgactgtcggcaagatccactgggccgacgagcaggcagtggag
caggcgctggcctcggcccatgccgccttcccgcgctggcgcgagactccggtgagtgag
cgtgccgccgcccttgagaaactggcggatctgctggaagcgaaccgcgagcagttcatc
tccctctgtacccgtgaggcgggcaagctgctgcaggacggcatcgacgaggtgcgcgag
gcggtggacttctgccgctactacgcggtgcaggcccgtggcctgatggggcaggcgacc
ctgctgcccggctacaccggcgagatgaacgagctgttcctgcaggggcgtggcgtgttc
gtctgcatcagcccgtggaacttcccgctggcgattttcctgggacaagtcgccgcagcg
ctggccaccggcaacaccgtcatcgccaagccggccgagcagaccggtctcatcgctcac
ctggcggtgaccctggctcatcaggccggcattcccggcgacgtgctgcaactgctgccg
ggtgacggcgccaccgtgggcgccaagctgacggcagatgcccgcatcggcggcgtctgc
ttcaccggctccaccgagaccgccaagctcatcaacatgactctggcccagcgcgatggc
gccatcctgccgctcatcgccgagaccggcggccagaatgccatgatcgtcgactccacc
gccctgccggagcaggtggtgcgcgatgtggtgagcgccgctttccagagcgccggccag
cgctgctccgccctgcgggtgctctacctgcaggaagagatcgcgccgcgggtgctggag
atcctgaccggtgccctgcaggagctcaaagtgggcaacccggccgagcacaacaccgac
gtcggcccggtcatcgacgccgaggccaaggccgggctggatgcgcacctggtgcacatg
atcccgcgtgcccgcctgatcgcccaggcaccgatgccggccgtgaccctggggggccac
ttcgtgcagccgaccgcgctggagatcggctccatccgcgagctgacccgcgagcagttc
ggccccatcctgcacgtggtgcgctacgccgcccgggatctggacaaggtgatcagcgac
atcaacggcaccggttacggcctgacgctggggatccacagccgcaacgaatcccatgcc
gaggagctggcgagccgcatcaatgtgggcaacgtctacatcaaccgcaaccagatcggc
gccatggtcggggtgcagccgttcggcgggcagggcctctccggcaccggtcccaaggcg
ggcggcccccattacctgagccgtttcattaccgagaagacccgcaccatcaacaccacg
gcggtgggcggcaacgcctccctgctggcgatgggcgacgcctga

DBGET integrated database retrieval system