KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1626
Entry
AHA_1626          CDS       T00424                                 

Definition
(RefSeq) glutamate dehydrogenase
  KO
K00262  glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00220  Arginine biosynthesis
aha00250  Alanine, aspartate and glutamate metabolism
aha00910  Nitrogen metabolism
aha01100  Metabolic pathways
aha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AHA_1626
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_1626
   00220 Arginine biosynthesis
    AHA_1626
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     AHA_1626
SSDB
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 4489171
NCBI-ProteinID: YP_856162
UniProt: A0KIR1
LinkDB
Position
complement(1775383..1776729)
AA seq 448 aa
MSHSLSQADFLAQVASRNPHQPEFIQAVSEVIASIWPYVVRHPRYLQHGLLERLVEPERL
IQFRVSWVDDRGQVQVNRGYRVQHSSAIGPFKGGMRFHPSVDTSVLKFLAFEQTFKNALT
TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMLELHRHLGADTDVPAGDIGVGGREVSYMA
GMMKKLTNSAECVFTGKGLSFGGSLIRPEATGYGLLYFVEAMLANRGQSLDGMTVSVSGS
GNVAQYAIEKAMALGARVITASDSGGTVYDPAGFTPEKLARLMALKNEQRKRIADYAHEE
GLEFFSGRTPWHLPTDVALPCATQNELDESDAATLIANGVQLVAEGANMPSSAAAIRRLY
EAKVLFAPGKAANAGGVATSGLEMSQNAQRLCWSREEVDARLKGIMTSIHATCVHYGQDE
TGHVNYESGANIAGFVKVADAMLAQGVC
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagtcattccctctcccaggcggattttctggcccaggtcgccagccgcaatccccac
caaccggagttcattcaggccgtgagcgaggtgatcgcctccatctggccctatgtggtg
cgccacccccgctacctgcaacacggcctgctggagcggctggtggagccggagcggctg
atccagtttcgggtgagctgggtggatgatcgaggccaggtgcaggtgaaccggggctac
cgggtacagcacagctccgccatcggccccttcaaggggggaatgcgctttcacccctcg
gtggatacctcggtgctcaagttcctcgccttcgagcagaccttcaagaatgccctcacc
accttgcccatgggcggtggcaaggggggcagcgattttgatcccaagggcaagagcgag
ggagaggtgatgcgcttttgccaggcgctgatgctggagctgcatcgccacctcggcgcc
gacaccgacgtgccggccggtgacatcggggtaggcgggcgcgaggtgagctacatggcg
ggcatgatgaagaagctcaccaacagcgccgagtgcgtctttaccggcaaggggctctcc
tttggcggcagcctgatccgcccggaagccaccggttacggcctgctctatttcgtcgag
gccatgctggccaaccgggggcaatccctggacggcatgacggtctcggtgtcgggttcg
ggcaacgtggcccagtacgccatcgagaaggcgatggccctcggcgcccgggtcatcacc
gcctccgactccggcggcaccgtctacgatccggcgggctttacccccgagaaactggcg
cggctgatggcgctcaaaaacgagcagcgcaaacgcatcgccgattacgcccacgaagag
gggctggagtttttcagcggccgcactccctggcacctgccgacggacgtcgccctgccc
tgcgccacccagaacgaactggatgagtcggacgccgccaccttgattgccaatggcgtg
caactggtggccgagggggccaacatgccgagcagcgccgccgccatccgtcgtctgtac
gaagccaaggtgctgtttgccccgggcaaggccgccaacgccggcggagtcgccacttcg
ggcctcgagatgagccagaacgcccagcgtctctgctggagccgggaagaggtggatgcc
cgcctcaaggggatcatgaccagcatccacgccacctgcgtgcactatggccaggatgag
acgggtcatgtgaactacgaaagcggcgccaacatcgccggcttcgtcaaggtggccgat
gccatgctggcccagggagtctgctga

DBGET integrated database retrieval system