KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1712Help
Entry
AHA_1712          CDS       T00424                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Brite
KEGG Orthology (KO) [BR:aha00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AHA_1712
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AHA_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 4488164
NCBI-ProteinID: YP_856248
UniProt: A0KIZ7
LinkDB All DBs
Position
1874693..1875355
Genome map
AA seq 220 aa AA seqDB search
MIDFYTAATPNGFKVAIALEELGLPYRVIPLDLSALDQKKPEFLAINPNGRIPAIVDRDN
GDFAVFESGAILLYLAEKAGKLLPADPKRRSQAIQWLMFQMGGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVLDSHLAHHEYLADEYSIADIATWPWVRIHDWSGISIEGLPH
LQAWMDRMAEKPACQKGITIPPRNEKPEDLVKQAQQMVTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttttacaccgccgctacgcccaatggcttcaaggtggcgattgccctggaa
gagctgggcttgccctatcgggtgatcccgctcgatctgtcggcgctggatcagaagaag
cccgagtttctggccatcaaccccaacggccgtatcccggccatcgtcgatcgggataat
ggtgacttcgccgtgttcgagtccggcgccatcctcctctatttggcggagaaggcgggc
aagttgctgccggcagatcccaaacgccgctcccaggccatccagtggttgatgttccag
atgggcggggtcggtcccatgatggggcaggccaacgtcttctatcgctacttcccggag
aagatcccggccgccatcgagcgctaccagaaggaggggcgccgtctgttcgaggtgctc
gacagccatctggcccatcacgaatatctggccgacgagtacagcatcgccgacatcgct
acctggccctgggtgcgcattcatgactggagtggcatctccattgaggggttgccgcat
ctgcaagcctggatggaccggatggcagagaagcccgcctgccagaaggggatcaccata
ccgccgcgcaacgagaagccggaggatctggtcaaacaggcccagcagatggtaacgcgt
tga

DBGET integrated database retrieval system