KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1939
Entry
AHA_1939          CDS       T00424                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00250  Alanine, aspartate and glutamate metabolism
aha00410  beta-Alanine metabolism
aha00640  Propanoate metabolism
aha00650  Butanoate metabolism
aha01100  Metabolic pathways
aha01120  Microbial metabolism in diverse environments
Module
aha_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AHA_1939
   00650 Butanoate metabolism
    AHA_1939
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_1939
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AHA_1939
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aha01007]
    AHA_1939
Enzymes [BR:aha01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AHA_1939
Amino acid related enzymes [BR:aha01007]
 Aminotransferase (transaminase)
  Class III
   AHA_1939
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-GeneID: 4488653
NCBI-ProteinID: YP_856470
UniProt: A0KJL9
LinkDB
Position
2119652..2121076
AA seq 474 aa
MTSQAPHGCDQHDHKLHGSGRADSEGDINLGEGRARWWAGQREAVQAGLAEDSRYFFHQA
LSTPCLDLLEGAQGSWLTSVSGKRYLDFHGNSVHQLGHGHPRVVAAVQQQLADLPFAPRR
YTHQVAIDCARTLAELAPGDLNRVLFAPGGSEVVGIALKLARFITGNSKVVSLWDAFHGA
SLDAISVGGEACFRAGMGPLMAGVERIPPPTRYRGVWYRGEGDDLHYADYLEYVIEKEGG
IGAFIAEPIRNTDVQVPSKAYWQRVREICDRHKVLLIVDEIPNALGRTGHWFSFEEFGIE
PDIICLGKGLGGGAVPFAALITRDRFNQAAAISLGHYTHEKSPIGCAAALATIETIREAG
LLTKAQEDGRFMAAELGKLAERHPLIGQVRGIGLLWALDLVVDHQSRTRNSQAAERLLYR
CLELGLSFKVSQGNVIQLSPPLNIARADLVRAITILDRALGELALSPKQEHHHD
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgacgagccaagcgcctcacggttgcgatcagcacgaccataagctgcacggcagcggc
cgtgccgacagcgaaggggatatcaaccttggcgagggtcgggcgcgctggtgggcgggt
cagcgcgaggcggtgcaggctggattggcggaggatagccgctactttttccatcaagcg
ctctccaccccctgtctcgatctgcttgagggggcgcaggggagctggctgaccagcgta
tcgggcaaacggtatcttgattttcacggcaacagcgtccatcagctgggtcacggccat
cccagggtggtggccgcagtgcagcaacaactcgccgatctgccgttcgcgccccgccgc
tacacccatcaggtcgctatcgactgcgcccgcactctggccgaactggcccccggcgat
ctcaaccgggtgctgttcgcccccggcggcagcgaggtggtggggattgccctgaagctc
gcccgtttcatcaccggcaatagcaaggtggtgtccctctgggatgcctttcacggcgcc
tccctcgatgccatctcggtcggcggagaagcctgctttcgcgctggtatgggcccgctg
atggccggagtggagcgcattcctccccccacccgctatcgcggtgtctggtatcgcggg
gaaggggatgacctgcactacgccgattatctggaatacgtcatcgagaaggagggaggg
atcggcgcctttatcgccgagcccatccgcaataccgatgtacaggtgccctcaaaagcc
tactggcagcgagtgcgggagatctgcgatcgccacaaggtgctgctgatcgtcgacgag
atcccgaatgccctggggcgcaccggccattggttcagcttcgaggagttcggcatcgag
cccgacatcatctgccttggcaaggggctgggaggcggggcggtgccgtttgcggcgctc
atcacccgcgaccgtttcaatcaggcggcggctatttcgctcggtcactacacccacgag
aagagccccatcggctgcgcggcggccctcgccacgatagagacaatccgcgaagcggga
ttgctgacaaaagcgcaggaggatggccgctttatggcggcagagcttggcaagttggct
gagcgtcacccgctgatcgggcaggtgcgcggcataggtcttttgtgggcgctcgatctg
gtggtcgatcaccagagtcgtacccgtaatagccaggccgccgagcggctgctctaccgc
tgtctggaactggggctcagcttcaaggtctcccagggcaacgtcattcagctctcgcca
ccgctcaatatcgcgcgcgccgatctggtgcgcgccatcaccattctcgatcgcgccctt
ggcgagctcgcactttcaccgaaacaggaacaccaccatgactga

KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3002
Entry
AHA_3002          CDS       T00424                                 

Gene name
gabT
Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00250  Alanine, aspartate and glutamate metabolism
aha00280  Valine, leucine and isoleucine degradation
aha00310  Lysine degradation
aha00410  beta-Alanine metabolism
aha00640  Propanoate metabolism
aha00650  Butanoate metabolism
aha01100  Metabolic pathways
aha01120  Microbial metabolism in diverse environments
Module
aha_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AHA_3002 (gabT)
   00650 Butanoate metabolism
    AHA_3002 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_3002 (gabT)
   00280 Valine, leucine and isoleucine degradation
    AHA_3002 (gabT)
   00310 Lysine degradation
    AHA_3002 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AHA_3002 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aha01007]
    AHA_3002 (gabT)
Enzymes [BR:aha01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AHA_3002 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AHA_3002 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     AHA_3002 (gabT)
Amino acid related enzymes [BR:aha01007]
 Aminotransferase (transaminase)
  Class III
   AHA_3002 (gabT)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-GeneID: 4488067
NCBI-ProteinID: YP_857506
UniProt: A0KMK5
LinkDB
Position
3381816..3383105
AA seq 429 aa
MSQSASNKAWQARREAAVVNGVGTLLPVFIERAQNAELWDVEGNRYIDFASGIAVLNTGH
NHPKVVAAVRAQLEKFSHTCFQVTPYPGYIELAEKLNALVPGPTPKRTLFLSTGAEAVEN
AIKIARAHTGRSGTIAFKGGFHGRTMMGMALTGKVVPYKTGFGPFPGEVYHLPFPSDYLG
VSEADALAALDLCFSSDIEPTRVAAIIIEPVQGEGGFYPASASFMQRLRQLCDQHGILLI
CDEIQSGFCRTGKTFATEYAGIEPDIMTLAKSLAGGFPLSAVVGKAEVMNAAKPGGLGGT
YAGSPIACAAALAVLEVIEEEQLNQRANTQGEQIKARLQQLAERFDCIGDIRGPGAMVAM
ELVKQRDAARPDADLTKRLVAEAGKRGLVLLACGVRANVIRFLAPLTASPALVDEGLDLL
EQALLAAQG
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgagtcagtcagcatcaaacaaggcgtggcaagcgcgccgcgaagcggccgtggtcaac
ggcgtcggcaccctgctgccggtgtttatcgagcgggcgcaaaacgccgagctgtgggat
gtggagggcaaccgctacatcgattttgcttccggcatcgccgtgctcaacaccggccac
aaccacccgaaagtggtggcggcggtgcgcgcgcagctggaaaaattcagccacacctgc
ttccaggtcaccccctaccccggctatatcgagctggcggaaaagttgaatgccctggtg
cccggccccaccccgaaacgcaccctgtttctctccaccggcgccgaggcggtggagaac
gccatcaagatcgcccgcgcccacaccggccgcagcggcaccatcgccttcaaggggggc
tttcacggccgcaccatgatggggatggcgctcaccggcaaggtggtgccctacaagacc
ggcttcggccccttcccgggagaggtctatcacctgcccttcccgagcgactatctgggg
gtgagcgaggccgatgcgctggctgcgctggatctctgcttcagctcggatatcgagcca
acccgggtggccgccatcatcatcgagccggtgcagggtgaagggggcttctaccccgcc
tccgccagcttcatgcagcgcctgcgccagctgtgcgatcagcacggcatcctgctcatc
tgcgacgagatccagagcggtttctgtcgcaccggcaagaccttcgccaccgaatatgcc
ggcatcgagccggacatcatgaccctggccaagagcctggccggcggcttcccgctctcc
gccgtggtgggcaaggcggaggtgatgaacgccgccaagccgggtggtctgggcggtacc
tatgccggctcccccatcgcctgcgctgccgccctggcggtgctggaggtgatcgaagag
gagcagctcaaccaacgggccaatactcagggcgagcagatcaaggcccgcctgcagcag
ctggcggagcgctttgactgcatcggcgacatccgcggccccggcgccatggtggccatg
gagctggtcaaacagcgcgatgcggccagaccggatgccgacctcaccaagcgactggtg
gccgaggcgggcaagcgtggactggtgctgctggcctgcggtgtgcgcgccaacgtcatc
cgcttcctggcgccgctgacggcctcgccggccctcgtcgacgaggggctggatctgctc
gagcaggccctgctggcagcccagggctga

DBGET integrated database retrieval system