KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2627Help
Entry
AHA_2627          CDS       T00424                                 

Definition
(RefSeq) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00220  Arginine biosynthesis
aha00250  Alanine, aspartate and glutamate metabolism
aha00290  Valine, leucine and isoleucine biosynthesis
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01130  Biosynthesis of antibiotics
aha01210  2-Oxocarboxylic acid metabolism
aha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_2627
   00290 Valine, leucine and isoleucine biosynthesis
    AHA_2627
   00220 Arginine biosynthesis
    AHA_2627
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aha01007]
    AHA_2627
Enzymes [BR:aha01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AHA_2627
    2.6.1.66  valine---pyruvate transaminase
     AHA_2627
Amino acid related enzymes [BR:aha01007]
 Aminotransferase (transaminase)
  Class I
   AHA_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 4490222
NCBI-ProteinID: YP_857136
UniProt: A0KLI5
LinkDB All DBs
Position
2928558..2929772
Genome map
AA seq 404 aa AA seqDB search
MFTIDKSHKLDDVCYDIRGPVHKEARRLEDEGHRIIKLNIGNPAPFGFDAPEEIIKDVIL
NMPLSQGYCDSKGLFSARKAVMQYYQQKGMRKVDIDDIYIGNGASELIVMAMQALLNNGD
EMLVPSPDYPLWTAAVTLSGGHAVHYRCDEGADWYPDLDDIRARITPRTRGLVLINPNNP
TGAVYGSEFLLEVIEIARQHNLIIFADEIYDKILYDDISHTSVCTLCDDVMVVTFNGLSK
AYRACGFRQGWMVITGPKGRAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLRRQRDKAWELLNDIPGVSCVKPKGALYMFPRLDPKVYDIRDDQKMVFDLLQQEK
LLLVQGTGFNWPAPDHFRLVFLPREEELEEAIGRLARFLKGYKQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcactatcgacaagtcgcacaagctcgacgatgtctgctatgacatccgcggcccg
gtgcataaagaagctcgccgtctcgaagacgaaggccaccgcatcatcaagctcaacatc
ggcaacccggccccgttcggtttcgatgcgccggaagagatcatcaaggatgtgatcctc
aacatgccgctcagccagggctactgcgactccaaggggctgttctcggcccgcaaggcg
gtgatgcagtactaccagcaaaaagggatgcgcaaggtcgacatcgacgacatctacatc
ggcaacggtgccagcgagctcatcgtgatggcgatgcaggcgctgctcaacaacggcgac
gagatgctggtgccctcccccgactatccgctctggacggcggcagtgaccctctccggc
ggccatgcggtgcactatcgctgcgacgaaggggccgactggtatccggatctcgacgac
atccgcgcccgcatcaccccgcgcacccgcggcctggtgctgatcaaccccaacaacccg
actggcgccgtctacggcagcgagttcctgctggaagtgatcgagatcgcccgccagcac
aacctcatcatcttcgccgacgagatctacgacaagatcctctacgacgacatctcccac
accagcgtctgcaccctgtgcgacgatgtgatggtggtgaccttcaacggcctctccaag
gcctaccgcgcctgtggcttccgtcagggctggatggtcatcaccggtcccaagggccgt
gccaagggctacatcgaggggctggagatgctggcctccatgcggctctgtgccaacgtg
ccgatgcagcacgccatccagaccgccctgggtggctaccagagcatcaacgagctgatc
ctgccgggcggccgcctgcgccgccagcgcgacaaggcgtgggagctgctcaacgacatt
ccgggggtctcctgcgtcaagcccaagggggcgctctacatgttcccgcgcctcgacccc
aaggtgtacgacatccgcgacgaccagaagatggtgttcgatctgctgcagcaggaaaaa
ttgctgctggtgcagggcaccggcttcaactggccggcaccggatcacttccggctggtg
tttctgccccgggaagaggagctggaagaagccatcggccgtctcgcccgcttcctcaag
ggctacaagcagtaa

DBGET integrated database retrieval system