KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2703
Entry
AHA_2703          CDS       T00424                                 

Gene name
gltB
Definition
(RefSeq) glutamate synthase subunit alpha
  KO
K00265  glutamate synthase (NADPH) large chain [EC:1.4.1.13]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00250  Alanine, aspartate and glutamate metabolism
aha00910  Nitrogen metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AHA_2703 (gltB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_2703 (gltB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aha01002]
    AHA_2703 (gltB)
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     AHA_2703 (gltB)
Peptidases and inhibitors [BR:aha01002]
 Cysteine peptidases
  Family C44
   AHA_2703 (gltB)
SSDB
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG FMN_dh
Other DBs
NCBI-GeneID: 4489981
NCBI-ProteinID: YP_857211
UniProt: A0KLR0
LinkDB
Position
3035884..3040341
AA seq 1485 aa
MSLYDPKLERDNCGFGLLAHMEGEASHKLVRLAMSALARMQHRGGISADGKTGDGCGLLL
QKPDSFFRAVAEEKGWHLGRNYAVGMLFLNPDPVLAQATRDIIDEELEKETLSLVGWRKV
PIDTNVLGPIAKASLPSIEQVFVNAPPGWVGKDLERRLYIVRRRIEKRISDDYFYVVSLS
NLVTVYKGLCMPVDLPRFYLDLADIRMQAAICVFHQRFSTNTSPRWPLAQPFRYLAHNGE
INTIAGNRQWAKARSYKFATPLIPDLQEAAPFVNTTGSDSSSLDNMLDLFLAGGMDLFRA
MRLLIPPAWQKHPNMDDDLRAFYDFNSMHMEPWDGPAGIVMTDGRYATCALDRNGLRPAR
YVITKDKFITLASEVGTWDYTPDEVLEKGRVGPGELFVVDTSNGKIWTSFEIDDDLKSRH
TYKQWMDKHCKRLVPFEQMDDASTGAREFSDDQLKTYQKLFGYSYEELDQIIRVLGENGQ
EAVGSMGDDTPMAVLSSSQRTLYDYFRQMFAQVTNPPIDPLRENHVMSLATCIGREQNVF
NETFGHAHRVLFQSPILLYSDFHQLLALEGEHYRHQVISLNFKPEEGLEAAILRICEEAK
AAAKAGTVLLILSDRDVSANTLPIPAAMAVGAVQRTLVDNNLRCDANILVETASVRDPHH
FSVLLGFGATAIYPYLAYETLAKQVEEGVLKMSLRQAMLNYRNGINKGLYKVMSKMGIST
VASYRCSQLFEAVGLSKAVVEMCFRGVSSRIQGADFADIQQDQFNLARQAWLARKALTQG
GLLKFVHGGEYHTYNPDVVQTLQTAVRSGNYADYKEYARLVNERPVATLRDLLTLKKVDN
PVALEQVEPAAKLFPRFDSAAMSIGALGPEAHEALAVAMNRLGGQSNSGEGGEDPKRFGT
EKNSRIKQVASGRFGVTPHYLMNADVVQIKVAQGAKPGEGGQLPGDKVTAQIAKLRYSVP
GVTLISPPPHHDIYSIEDLAQLIFDIKQINPSCLVSVKLVSEPGVGTIACGVAKAYADFI
TVSGYDGGTGASPLTSVKYAGSPWELGLAETQQALVANGLRHKVRLQVDGGLKTGLDIIK
AAILGAESFGFGTGPMVALGCKYLRICHLNNCATGVATQDEKLRREHFTGLPEMVMNYFK
FIAEETRELMAQLGVTQLTDLIGRTDLLEALPGLTARQAKLDLSGILASPVAPAGSSLFS
QQHNPTFDKGPLNLKMVEDLLEAVENMSGGEFRYDIRNTDRSVGARLSGEIVKRHGNQGM
AADPVRVHFNGTAGQSFGVWNAGGLEMILTGDANDYVGKGMTGGKLVIKPHVGVAFKSHE
AAIIGNTCLYGATGGKLYAAGTAGERFAVRNSGALAVVEGIGDNGCEYMTGGIVTVLGTT
GVNFAAGMTGGFAYVLDECGNFAKRTNPELVELLDVADLAIHQEHLRGIITAHLNETGSS
RAEEILANFDSYVPKFRLIKPKSSDVKSLLGHTSRSSAELRIQAQ
NT seq 4458 nt   +upstreamnt  +downstreamnt
atgtcactatatgatccaaagctggagagggataactgtggcttcggcctgttggcccac
atggaaggtgaagccagccacaagcttgtccgtctcgcgatgtcagcattggctcgcatg
cagcaccgtggcggcatctctgccgacggcaagaccggcgacggctgcggtctgttgctg
caaaaacccgacagcttcttcagagctgtcgccgaagagaagggatggcacctgggccgc
aattacgcggtcggcatgctgtttctcaaccccgatcccgtcttggcgcaagccactcgc
gacatcatcgacgaagagctggagaaggagaccctgagtctggtcggttggcgcaaggtg
cctatcgataccaatgtactcggcccgatcgccaaggcctccctgcccagcatcgaacag
gtttttgtcaacgccccgcccggctgggtcggcaaagatctcgagcgccgcctctatatc
gtgcgccgccgcatcgagaaacgcatcagcgacgactacttctacgtggtcagcctctcc
aacctggtcaccgtctataaaggactgtgcatgccggtggacttgccgcgtttttatctg
gatttggccgacattcgcatgcaggcggccatctgcgtattccaccagcgtttctccacc
aacaccagcccgcgctggccgctggcgcagccgttccgctacctcgcccacaacggcgag
atcaacaccatcgcgggcaaccgccagtgggccaaggcgcgcagctacaagtttgccacc
ccgctgatccccgatctgcaagaggccgcccccttcgtcaacactacggggtcggactcc
tccagcctcgacaacatgctggatctgttcctggccggcggcatggacctgttccgcgcc
atgcgcctgttgatcccgcctgcgtggcagaagcacccgaacatggatgacgacctgcgc
gccttctacgacttcaactccatgcacatggagccctgggatggcccggccggcatcgtc
atgaccgacggtcgctacgccacctgcgcgctcgacagaaacggcctgcgtccggcccgc
tacgtcatcaccaaggacaagttcatcacgctggcctctgaagtgggcacctgggactac
accccggacgaagtgctggagaagggccgggtcggcccgggcgagctgttcgtggtcgat
accagcaacggcaagatctggaccagcttcgagatcgatgacgatctcaagagccgtcac
acctacaaacagtggatggacaagcactgcaagcggctggtgccgtttgagcagatggat
gacgccagcacaggcgcccgcgagttctccgacgatcaactgaaaacctatcagaagctg
ttcggctactcctatgaggagctggatcagatcatccgggtactgggtgaaaacggccag
gaagcggtgggttccatgggagatgacactccgatggcggtgctctcctccagccagcgc
accctgtacgactacttccgccagatgttcgcccaggtcaccaacccgcccatcgatccg
ctgcgggaaaaccacgtcatgtcgctggccacctgtatcggccgcgagcagaacgtgttc
aacgagaccttcggccacgcccaccgggtgctgttccagtcgccgatcctgctctactcc
gacttccaccagctgctggcgctggaaggggagcactatcgccatcaggtgatcagcctc
aacttcaagcccgaagagggcctggaagcggccatcctgcgcatctgtgaagaggccaag
gctgccgccaaggccggtaccgtgctgctgatcctctcggatcgggacgtcagtgccaac
accctgcccatcccggccgccatggcggtgggggcggtgcagcgtaccctggtggacaac
aacctgcgctgcgacgccaacatcctggtggagaccgccagcgtgcgcgacccgcaccac
ttctcggtgttgctgggctttggcgccaccgccatctacccctacctcgcctacgagacg
ctcgccaagcaggtagaagagggcgtgctcaagatgagcctgcgccaggccatgctcaac
taccgcaacggcatcaacaaggggctctacaaggtgatgtccaagatgggcatcagcacg
gtggccagctaccgctgctcccagctgtttgaagcggtgggcctctccaaagccgtggtc
gagatgtgttttcgcggcgtatcgagccgcatccagggcgccgattttgccgacatccag
caggatcagttcaatctggcccgtcaggcctggctggcccgcaaggccctcactcagggc
ggcctgctaaaattcgtccacggcggcgagtaccacacctacaacccggacgtggtgcag
accctgcagaccgcggtgcgctccggcaattatgccgattacaaggagtacgcccgcctg
gtgaacgaacggccggtcgccaccctgcgcgatctgctcaccctgaagaaggtcgacaac
ccggtggcactggagcaggtagagccggcagccaagctgttcccccgcttcgactctgcc
gccatgtccatcggcgcgctgggcccggaagcccacgaagcgctggcggtggctatgaac
cggctcggcggccagagcaactcgggtgaaggcggcgaggatcccaagcgcttcggcacc
gagaagaattcgcgcatcaagcaggtggcctcggggcgctttggcgtcaccccccactac
ctgatgaacgccgacgtggtgcagatcaaggtggcccagggtgccaagcccggtgaaggg
ggccagctgcccggtgacaaggtgacggcccaaatcgccaagctgcgttactcggtgccc
ggcgtgaccctgatctcgccgccaccccaccacgacatctactccatcgaggatctggcc
cagctcatcttcgacatcaagcagatcaacccaagctgcctggtgtcggtgaaactggtg
tccgagcccggcgttggtaccatcgcctgcggcgtggccaaggcctatgcggacttcatc
accgtctccggctacgacggcggcaccggcgcgagccccctcacctcggtcaaatacgcc
ggctctccctgggagctggggctggccgagacccagcaggcactggtcgccaacggcctg
cgccacaaggtgcggctgcaggtggacggtggcctcaagacgggtctggacatcatcaag
gcggccattctcggcgccgagagcttcggttttggcaccggccccatggtggcgctcggc
tgcaaatacctgcggatctgccacctgaacaactgcgccaccggcgtcgccacccaggat
gagaagctgcgccgcgagcacttcaccggcctgccggagatggtgatgaactacttcaag
ttcatcgccgaggagacccgcgagctgatggcccagctgggcgtcacccagctgaccgac
ctcatcggtcgcaccgacctgctggaagcgctgcccggcctcaccgcccgtcaggccaag
ctggatctctccggcattctggccagcccggtggcaccggcaggctccagcctgttcagc
cagcagcacaaccccaccttcgacaaggggcctttgaacctcaagatggtggaagatctg
ctggaggcggtggaaaacatgagcggcggcgagtttcgctacgacatccgcaacaccgac
cgctcggtgggggcgcgtctgtccggcgagatcgtcaagcgccatggcaaccaggggatg
gcggccgatccggtgcgggttcacttcaacggtaccgccggccagagcttcggcgtctgg
aacgcgggtggccttgagatgatcctcacgggggatgccaacgactacgtgggcaagggg
atgaccggcggcaagctggtgatcaaaccccacgtcggcgtggcattcaaatcccacgag
gcggccatcatcggcaacacctgcctctacggcgccaccggcggcaaactttacgctgcg
ggtaccgccggcgagcgcttcgcggtgcgcaactcaggggcgctggcggtagtcgagggg
atcggtgacaacggttgtgaatacatgaccggcggcatcgtcaccgtgctcggcaccaca
ggcgtcaacttcgcggcgggcatgaccggcggctttgcctacgtgctcgacgagtgcggc
aactttgccaagcgcaccaaccccgagctggtagaactgctggacgtggcggatcttgcc
atccatcaggagcacctgcgcggcatcataacggcgcacctcaacgaaaccggcagctcg
cgcgccgaggagatcctggccaacttcgactcctatgtgcccaagttcaggctgatcaaa
cccaagtccagcgacgtcaaatcgctgcttggccacaccagccgttccagtgcagaactc
agaatccaggcgcaataa

KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2704
Entry
AHA_2704          CDS       T00424                                 

Gene name
gltD
Definition
(RefSeq) glutamate synthase subunit beta
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00250  Alanine, aspartate and glutamate metabolism
aha00910  Nitrogen metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AHA_2704 (gltD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_2704 (gltD)
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     AHA_2704 (gltD)
SSDB
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox_3 Pyr_redox NAD_binding_8 FMO-like FAD_oxidored Thi4 FAD_binding_3 HI0933_like NAD_binding_7 FAD_binding_2 DAO Shikimate_DH 2-Hacid_dh_C GIDA Fer4_7
Other DBs
NCBI-GeneID: 4489982
NCBI-ProteinID: YP_857212
UniProt: A0KLR1
LinkDB
Position
3040354..3041769
AA seq 471 aa
MSQNVFQFIDVQRVDPPKKPLKIRKIQFVEIYESFNQAQVGMQADRCLDCGNPYCEWKCP
VHNYIPNWLKLANEGRILEAVELSHQTNSLPEVCGRVCPQDRLCEGACTLNDRFGAVTIG
NIEKYITDKAFEMGWKPDLSKVVKTGKRVAVIGAGPAGLACADVLARGGVTPVVFDKYPE
IGGLLTFGIPSFKLEKEVMQRRREIFEGMGVEFRLETEVGRDVTFADLLGEFDAIFLGVG
TYKYMKGGFANEEAPGVYDALPYLIANANRLLGFEKAQADYIDFAGKQVVVLGGGDTAMD
CVRTAIRQGADKVICAYRRDEENMPGSKREVKNAREEGVEFMFNLQPVGVELDAQGRTCG
IKVVSTELGAPDANGRRNPVVVTGSEQVLAADAVVMAFGFQPNPQPWMAEHGIELDGRDR
IKASEQAEHAFQTSNPKVFAGGDAVRGSDLVVTAIYEGRKAAEGIMDYLAV
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgagccagaacgtatttcagtttatcgacgtgcagcgggtcgacccgcccaagaagccg
ctcaagatccgcaagatccagttcgtggaaatctacgagtccttcaaccaggcccaggtc
ggcatgcaggcggatcgctgcctcgactgcggcaacccttactgcgagtggaagtgcccg
gtgcacaactacatccccaactggctgaagctggccaacgaggggcgcattctggaggcg
gtggagctctcccaccagaccaacagcctgccggaggtgtgtggccgagtctgtccgcaa
gacagactgtgtgagggtgcctgcaccctcaacgatcgcttcggcgccgtcaccatcggc
aacattgaaaaatacatcaccgataaggcgttcgagatgggctggaagcccgatctctcc
aaggtggtcaagaccggcaagcgggtcgccgtcatcggcgccggcccggcgggtctcgcc
tgcgccgacgtgctggctcggggcggcgtcaccccggtggtgttcgacaagtatccggag
atcggcggtctgctcacctttggcatcccctccttcaagctggaaaaagaggtaatgcag
cgtcgccgcgagatcttcgagggaatgggggtggagtttcgcctcgagaccgaggtgggc
cgcgatgtcaccttcgccgacctgctcggcgagttcgatgcgatcttcctcggggtcggc
acctacaagtacatgaagggcggctttgccaacgaggaggcaccgggagtctacgacgcc
ctgccctacctcatcgccaacgccaaccggttgctgggctttgagaaggcgcaagccgat
tacatcgacttcgccggcaagcaggtggtggtgctcggcggcggtgataccgccatggac
tgcgtgcgtaccgccatccgtcagggggccgacaaggtcatctgcgcctatcgccgcgac
gaggagaacatgccgggctccaagcgggaggtgaagaatgcccgcgaggagggggttgaa
ttcatgttcaacctgcagccggtcggcgtcgagctcgatgcccagggccgcacctgcggc
atcaaggtggtgagcaccgagctcggcgcccccgatgccaatggccgccgcaacccggtg
gttgtgacaggctccgagcaggtgctggctgccgatgcggtggtgatggcgttcggcttc
cagcccaatccccaaccctggatggcggaacacggcatcgagcttgacggccgggatcgc
atcaaggcctcggagcaggccgaacatgccttccagaccagcaaccccaaggtgttcgcc
ggtggcgacgcggtacgtggctccgatctggtggtgaccgccatctatgaggggcgcaaa
gcggccgaagggatcatggactatctggccgtgtga

DBGET integrated database retrieval system