KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3026Help
Entry
AHA_3026          CDS       T00424                                 

Gene name
arcA-1
Definition
(RefSeq) two-component response regulator
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aha00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AHA_3026 (arcA-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:aha02022]
    AHA_3026 (arcA-1)
Two-component system [BR:aha02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   AHA_3026 (arcA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-GeneID: 4489051
NCBI-ProteinID: YP_857530
UniProt: A0KMM9
LinkDB All DBs
Position
3413555..3414274
Genome map
AA seq 239 aa AA seqDB search
MQTPHILIVEDELVTRNTLKSIFEAEGYIVLEANNGDEMHQALTSHTINLVIMDINLPGK
NGLLLARELREDDNIALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNVAAGGEEKKLVERYLFNGWALDINSRALVSPAGDMFKLPRSEFRAMLHFCENPGQIQ
TRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESVNDTPEIIATIHGEGYRFCGELEQE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaccacacattctgatcgtcgaagacgaactggtcactcgcaataccctgaaa
agcatcttcgaggcagagggctatatcgtgctcgaagccaacaatggcgacgagatgcat
caggctctgacttcccacaccatcaatctggtgatcatggacatcaacctgccgggcaag
aatggcctgctgctggcacgcgagctgcgtgaggacgacaacatcgccctgatgttcctg
acgggtcgtgacaacgaagtggacaagatcctgggtctggagatcggtgccgacgattac
atcaccaagccgttcaacccccgtgagctgaccatccgtgcccgcaacctgctgagccgc
accatgaacgtggccgccggtggtgaagagaagaagctggtggagcgttacctgttcaac
ggctgggcactggacatcaacagccgcgccctggtcagcccggctggcgacatgttcaag
ctgccgcgctccgaattccgcgccatgctgcacttctgcgaaaacccgggccagatccag
acccgcgccgagctgctcaagaagatgaccggccgtgagctcaagccccacgaccgcacc
gtggatgtcaccatccgccgcatccgcaagcacttcgagagcgtcaacgacactccggag
atcatcgccaccatccacggcgaaggctatcgcttctgcggcgagctggagcaggagtaa

DBGET integrated database retrieval system