KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3113
Entry
AHA_3113          CDS       T00424                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00230  Purine metabolism
aha00250  Alanine, aspartate and glutamate metabolism
aha01100  Metabolic pathways
Module
aha_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AHA_3113 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_3113 (purA)
Enzymes [BR:aha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     AHA_3113 (purA)
SSDB
Motif
Pfam: Adenylsucc_synt
Other DBs
NCBI-GeneID: 4489040
NCBI-ProteinID: YP_857613
UniProt: A0KMW2
LinkDB
Position
3517441..3518697
AA seq 418 aa
MSSIVVVGANWGDEGKGRIVDYLAGQAGASIRFQGGNNAGHTVVNDLGTFKLHQVPSGVF
NPDCLVVLGPGMVISPEKLTVELDEVKASGVTPKLAISDRATLCLPLHAMEDTLEEQRLG
DGAYGSTRQGIAPAYGDRVMKKAILVGWLKQPEVLVERIQFFLDWKLPQLKALYPTFEFN
QTAQEMADWLLEVSAPWIDSVCNVSMPLKALQAEGKTLLFEAQLGAGRDLIYGEYPWVTS
SHVSGAYAGIGGGLPGLRPERVIAVAKAFSTSVGTGTLLTAMENQDEFRKIANEFGATTG
RPRDVGYFDAVATKNGVELQAANEVALTKLDCLTGLPDLKICVAYEGAHTENPIWPQTAG
LKPVYEVMESWSEDITGCRTFAELPKAAQQYVLRIEELLGVPVPMVSVGPGRDEMILR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtcgtctatcgtagtcgtaggtgccaactggggtgatgaaggcaaaggccgcatcgtg
gattatctggcaggccaagcaggcgccagcattcgcttccagggcggcaacaacgccggc
cataccgtcgtcaacgaccttggcaccttcaagctgcaccaggttccgagcggtgtgttc
aacccggattgcctggtcgtgctcggccctggcatggtgatcagccccgagaaactgacc
gtcgagctggacgaagtgaaagcctccggcgtcactcccaagctggccatctctgatcgt
gccaccctctgcctgccgctgcacgccatggaagataccctggaagagcagcgcctgggc
gacggcgcctacggttccacccgtcagggcatcgctcccgcctatggcgatcgcgtcatg
aagaaagcgatcctggtgggctggctgaaacagccggaagtactggtcgagcgcattcaa
ttcttcctcgactggaaactgccgcagctcaaagcgctctacccgaccttcgaattcaac
cagaccgcccaggagatggctgactggctgctggaagtgtccgccccctggatcgactcc
gtctgcaacgtcagcatgccgctcaaagcgctgcaggccgaaggcaagaccctgctgttc
gaagcccagctgggcgccggtcgtgacctgatctacggcgaatacccctgggtgacctcc
tcccacgtgtccggcgcctatgccggcatcggtggcggcctgccgggtctgcgtcccgag
cgcgtcatcgccgtcgccaaggcattcagcacctccgtcggtaccggcaccctgctgacc
gccatggaaaaccaggacgagttccgcaagatcgccaacgagttcggcgccaccaccggt
cgtccccgtgacgtcggctacttcgacgccgtcgccaccaagaatggtgtcgagctgcag
gctgccaacgaagtggcgctgaccaagctggactgcctgaccggtctcccggatctgaag
atctgcgtcgcctacgaaggtgcccacaccgagaacccgatctggccgcaaactgccggt
ctgaagccggtttacgaagtgatggaaagctggagcgaagacatcaccggctgccgtacc
ttcgccgagctgcccaaagcggctcagcagtacgtactgcgcatcgaagagctcctgggc
gtaccggtgccgatggtctccgtcggcccgggccgtgacgagatgatcctgcgctaa

DBGET integrated database retrieval system