KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3365
Entry
AHA_3365          CDS       T00424                                 

Gene name
ansA
Definition
(RefSeq) asparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00250  Alanine, aspartate and glutamate metabolism
aha00460  Cyanoamino acid metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_3365 (ansA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AHA_3365 (ansA)
Enzymes [BR:aha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     AHA_3365 (ansA)
SSDB
Motif
Pfam: Asparaginase Asparaginase_C
Other DBs
NCBI-GeneID: 4489459
NCBI-ProteinID: YP_857854
UniProt: A0KNK3
LinkDB
Position
complement(3789179..3790186)
AA seq 335 aa
MKKSIYIAYTGGTIGMQRSDHGYVPMAGFMEDCLARMPEFHRPEMPDYHIHEYAPLIDSS
DMTPADWQRIAEDIKGNYDKYDGFVILHGTDTMSFTASALSFMLEDLHKPVIITGSQIPL
AELRSDGQQNLLNALYIAANYPIHEVTLFFNNQLYRGNRSKKVHADGFHAFDSPNYPPLL
NAGIAISLEAGELGVPSERPLVLHDITPQPIGVVTLYPGISAEVIANILQQPVRALILLS
FGVGNAPQNPAMLALLSEASARGVIIVNLSQCLHGKVNMGGYATGNALSRAGVISGFDMT
AEAALTKLHFLLSQDLPAPRIRELMQQSLRGELTP
NT seq 1008 nt   +upstreamnt  +downstreamnt
gtgaagaagtccatctacatcgcctacacaggcggcaccatagggatgcagcgttccgac
cacggttatgtgccgatggcgggcttcatggaagactgtctggcgcggatgcccgagttc
catcgccccgagatgccggattaccatattcacgaatatgcgcccctcatcgactcttcc
gacatgacgccggcggactggcagcgcatcgctgaggatattaaaggcaactacgacaag
tacgacggtttcgtcattctgcacggcaccgacaccatgtcgttcactgcctcggcgctc
tccttcatgctcgaggatctgcacaagccggtgatcatcaccggctcccagatcccgctc
gccgagctgcgctccgacgggcagcagaacctgctcaacgccctctacatcgcggccaac
tacccgatccacgaggtgacgctgttcttcaacaaccagctctatcgcggcaaccgcagc
aagaaggtgcacgccgacggcttccacgccttcgattcgcccaactacccgccgctgctc
aatgccggtatcgccatctcgctggaagcgggcgaactgggggtgccgtccgagcggccg
ctggtgctgcacgacatcactccccagcccatcggcgtggtgaccctctaccccggcatc
tcggccgaggtgatcgccaacatcctgcagcagccggtgcgggcgctgatcctgctctcc
ttcggggtgggcaatgcgccgcagaatccggccatgctggcgctgctctccgaggcctcg
gcccgcggcgtcatcatcgtcaacctgagccagtgcctgcacggcaaggtcaacatgggc
ggctatgccaccggcaatgcgctgtcccgggccggggtcatctcgggcttcgacatgacc
gccgaggcggcgctgaccaagctgcacttcctgctgagccaggatctgccggcgccgcgc
atccgcgagctgatgcagcagtccctgcgcggggagctgactccctga

KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3828
Entry
AHA_3828          CDS       T00424                                 

Definition
(RefSeq) type II L-asparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00250  Alanine, aspartate and glutamate metabolism
aha00460  Cyanoamino acid metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_3828
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AHA_3828
Enzymes [BR:aha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     AHA_3828
SSDB
Motif
Pfam: Asparaginase Asparaginase_C
Other DBs
NCBI-GeneID: 4489928
NCBI-ProteinID: YP_858271
UniProt: A0KPS0
LinkDB
Position
4253059..4254117
AA seq 352 aa
MTLPIRKTLLAAVLGLTLSPMAMALPNVHILATGGTIAGAGQSATQSNYEAGKVAIETLI
AAVPEMKNVADVQGEQVVKIGSQDMNDEVWLKLAKRVNELLAKDDVDGIVITHGTDTMEE
TAYFLNLTVKSDKPVVLVGAMRPSTAMSADGPMNLYNAVVTASDPASKGRGVMVAMNDTV
LDARDVTKTNTTGVQTFASPNFGPLGYIHNGKIDYQRSPARLHTSKTPFDVSKLDKLPQV
GIVYSYANATDLPAKAMVDAKFDGIVSAGVGNGNLYHTLFDTLAKASKDGIRVVRSARVP
TGSTTLDAEIDDAKYGFVAAETLNPQKARILLMLSLTQSKDPAQIQRWFQQF
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgactctcccgatccgcaagaccctgctcgccgccgtcctcggcctgaccctctccccg
atggccatggccctgcccaacgtccatatcctggccaccggcggtaccattgccggggcg
ggacagtccgccacccagtccaactacgaggccggtaaggtggccatcgagacgctgatc
gccgccgtgcccgagatgaagaacgtggccgacgtgcagggtgagcaggtggtcaagatc
ggctcccaggacatgaacgacgaggtgtggctcaaactggccaagcgggtcaacgagctg
ctggccaaggatgacgtggacggtatcgtcatcacccacggcaccgacaccatggaagag
accgcctacttcctcaacctgaccgtcaagagcgacaagccggtggtgctggtcggcgcc
atgcgcccctccaccgccatgagcgccgacggtccgatgaacctctacaacgccgtggtg
accgcctctgaccccgcctccaagggacgtggcgtcatggtggcgatgaacgacaccgtg
ctcgatgcccgcgacgtcaccaagaccaacaccaccggggtgcagaccttcgcctccccc
aacttcggcccgctcggctacatccacaacggcaagatcgactatcagcgcagcccggcc
cgtctgcataccagcaagaccccgtttgacgtgagcaagctcgacaagctgccgcaggtc
ggcatcgtctacagctacgccaacgccaccgatctgccggccaaggcgatggtggatgcc
aagttcgacggcatcgtcagcgccggggtgggcaacggcaacctctaccacaccctgttc
gacaccctggccaaggcgagcaaggacggtatccgggtagtgcgctccgctcgcgtgccg
accggttccaccactctggatgccgagatcgatgacgccaagtacggcttcgtcgccgcc
gagaccctcaacccgcagaaagcgcggatcctgttgatgctctcgctcacccagagcaag
gatccggcccagatccagcgctggttccagcagttctga

DBGET integrated database retrieval system