KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3590
Entry
AHA_3590          CDS       T00424                                 

Definition
(RefSeq) aspartate racemase
  KO
K01779  aspartate racemase [EC:5.1.1.13]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00250  Alanine, aspartate and glutamate metabolism
aha01054  Nonribosomal peptide structures
aha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHA_3590
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    AHA_3590
Enzymes [BR:aha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.13  aspartate racemase
     AHA_3590
SSDB
Motif
Pfam: Asp_Glu_race DUF3663
Other DBs
NCBI-GeneID: 4489741
NCBI-ProteinID: YP_858060
UniProt: A0KP59
LinkDB
Position
complement(4032410..4033102)
AA seq 230 aa
MKCIGLLGGMSWESTVSYYQALNRGVRERLGGLHSARVLLSSVDFAEIERLQHIGDWPAT
ARLLAAEAQAIQAGGADFLLIGTNTMHKVAPEIEAAIDIPLLHIADATARQLQADGIQKV
GLLGTRFTMEQDFYKGRLQDKFGLEVLVPGEAQRERVHRIIYDELCLGDIRDASRAEYLA
IISALADAGAQAVILGCTEIALLVGEAEAAVPLYDTTAIHAEAAVTLALA
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaaatgtatcggtctgctgggtggcatgagctgggagtccaccgtcagctactatcag
gcgctcaaccggggcgtgcgcgagcggctcggtggcttgcactcggcgcgggtgctgctg
agcagcgtcgactttgccgagatagagcggctgcagcacatcggcgactggcccgccacc
gcccgtctgctggcggccgaggcgcaggccatccaggccggcggcgccgactttctgctg
atcggcaccaacaccatgcacaaggtggcgcccgagattgaggccgccatcgacatcccg
ctgctccatattgccgatgccaccgcgcgtcagctgcaagcggacgggatccaaaaggtc
ggtctgctcggcacccgcttcaccatggagcaggatttctacaaggggcgcttgcaggac
aaattcggactggaggtgctggtgcccggcgaggcgcagcgggagcgggtacaccgcatc
atctatgacgagctgtgcctcggcgacattcgcgacgcatcgcgggccgagtacttggcc
atcatcagcgcgctggccgacgcgggagcccaggcggtgatcctcggctgcaccgagata
gccctgttggtgggggaggccgaggccgcggtgccgctctacgacaccactgccattcac
gccgaggcggcggtaaccctggcgctggcttga

DBGET integrated database retrieval system