KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3787
Entry
AHA_3787          CDS       T00424                                 

Gene name
mutY
Definition
(RefSeq) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:aha00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AHA_3787 (mutY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aha03400]
    AHA_3787 (mutY)
Enzymes [BR:aha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     AHA_3787 (mutY)
DNA repair and recombination proteins [BR:aha03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     AHA_3787 (mutY)
 Prokaryotic type
     AHA_3787 (mutY)
SSDB
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S Whib HHH_5 HHH_8
Other DBs
NCBI-GeneID: 4487797
NCBI-ProteinID: YP_858235
UniProt: A0KPN4
LinkDB
Position
4215293..4216354
AA seq 353 aa
MNNSDNATFATRILDWYQLHGRKTLPWQQEKTPYRVWVSEIMLQQTQVATVIPYYQRFMA
RFPDVLALADAPIDEVLHHWTGLGYYARARNLHKAAQQIRDLHGGLFPERLEEVMALPGI
GRSTAGAVLSLSLGQPHAILDGNVKRVLTRWLALPGWPGQKQVENDLWELATRFTPKLGV
AHYNQAMMDMGATVCTRSKPACERCPVREDCQGLSQGNPTAYPNSKPKKSIPARTGIMLL
IRHGDQLLLEKRPPQGIWGGLYCFPQVESDAEVAGLLQRLGLTGSEPRELAGFRHTFSHF
HLDIRPMLLETDAPPAPLLMEADNRLWYNLRHPAEVGLAAATARLLAYPDLQP
NT seq 1062 nt   +upstreamnt  +downstreamnt
gtgaacaactcagataacgcgaccttcgccaccaggatcctggactggtatcagctccac
ggccgcaagaccctgccctggcaacaggagaagaccccctaccgggtctgggtctcggaa
atcatgctgcagcagacccaggtcgctacggtcattccctactatcagcgcttcatggcc
cgctttcccgacgtgctggcactggccgacgcccccatcgacgaggtgctgcaccactgg
accgggctcggctattacgcccgcgcccgcaacctgcacaaggcggcccagcagatccgc
gacctccatggcggcctcttcccggagcggctggaggaggtgatggcgctgccggggatc
ggccgctccaccgcgggcgccgtgctctccctctcccttggccagccccacgccattctg
gatggcaacgtgaagcgggtgctcacccgctggctggccctgcccggctggcccggccag
aagcaggtggagaacgatctgtgggagctggccacccgcttcacccccaagctcggggtg
gcccactacaaccaggccatgatggacatgggtgccaccgtctgcacccgcagcaagccc
gcttgcgagcgttgcccggtgcgggaggattgccaggggctgtcgcagggcaaccccacc
gcctaccccaacagcaagcccaagaagagcatcccggcccgtaccggcatcatgctgctc
atccgccacggcgatcagctgctgctggagaagcggccgccgcaagggatctggggcggg
ctctactgcttcccccaggtggagtcggacgccgaggtggcggggctgttgcagcggctc
ggcctgaccggtagcgaaccccgcgaactggccggttttcgccatacattcagccacttt
cacctcgatatccggcccatgctgctcgaaaccgacgcgccgccggcccccctgctcatg
gaagcggataaccgactctggtataacttacgccatcctgcagaggtgggtctggcggcc
gccacggcccgtctgctcgcctatccggacttacaaccatag

DBGET integrated database retrieval system