KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3888Help
Entry
AHA_3888          CDS       T00424                                 

Gene name
murF
Definition
(RefSeq) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00300  Lysine biosynthesis
aha00550  Peptidoglycan biosynthesis
aha01100  Metabolic pathways
aha01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    AHA_3888 (murF)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AHA_3888 (murF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AHA_3888 (murF)
Enzymes [BR:aha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     AHA_3888 (murF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-GeneID: 4490858
NCBI-ProteinID: YP_858327
UniProt: A0KPX6
LinkDB All DBs
Position
complement(4319894..4321249)
Genome map
AA seq 451 aa AA seqDB search
MMTLRLAELAQVLDARLIGEDGAITAVSTDTRTLGAGALFVALRGERFDAHDFCEQAVAA
GASALLVERELPLAIPQLVVTDSLKGLGRLGRLVRERINPKVLAITGSCGKTTVKEMATA
ILRQEGDVLATAGNFNNEVGVPLTLLRLEPQHRFAVMELGANHPGEIAWTTSLAKPDAAI
INNVAAAHLEGFGSLEGVFHAKSEIFEGLGEGGTAIVNADNEFWPKWQARGIHCAFSIED
QRQPFHARNVVINQQGCAEFVMVTPQGEISLTLAIPGRHNVANALAAAAGTLALGASLAS
VKAGLELMAPVKGRFCVQRWGGLTLVDDTYNASVESVLAGIDALTAMSGYKVLVFGDMKE
LGEESAEQHARVGRHASERGLDAVLTVGEQSRHTADAAAGRHFDNKASLFEVLAQMINTH
QEIAILVKGARGSRMEDIVEMVKDRQESATC
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccctcaggcttgccgagctggcgcaggtactcgatgcccgtctgattggtgaa
gacggagcgatcacggctgtcagcaccgacacccgtaccctgggcgcaggcgcgctgttt
gttgcgctgcgcggcgagcgtttcgatgcccacgatttctgcgagcaggccgtggccgcc
ggagcatcggcccttctggtcgagcgtgaactgccgttggcgatcccccagctggtggtg
accgacagtctcaagggactgggtcgcctcggtcggttggtgcgcgagcggatcaacccg
aaagtgctggccatcaccggcagctgtggcaagaccactgtgaaggagatggcgaccgcc
atcctgcgtcaggaaggggacgtgctggccaccgccggcaacttcaacaacgaagtgggg
gtgccgctgaccctgctgcgcctcgagccgcaacaccggtttgcggtgatggagctgggg
gccaaccacccgggcgagatcgcctggactacctcgttggccaaacccgatgccgccatc
atcaacaacgtggcggccgcccacctggagggcttcggctcgctggaaggggtgtttcac
gccaagagcgaaatcttcgaggggctgggcgagggcggaaccgccatcgtcaatgccgac
aacgaattctggccaaagtggcaggcccgcgggatccactgcgccttctccatcgaggat
cagcgtcagccgttccacgccagaaacgtggtgatcaaccagcagggttgtgccgagttt
gtcatggtgaccccgcagggtgaaataagcctgaccctggccattccgggccgccataac
gtggcgaacgccctggccgccgccgctggcacgctggcgctcggcgcctcgctcgcctcg
gtcaaggccgggctcgagctgatggcaccggtcaagggccgtttctgcgtccagcgctgg
ggtggtctcaccctggtggacgacacctacaacgccagcgtggagtccgtgctggcgggc
atcgatgccctgaccgccatgagtggctacaaggtgctggtgttcggtgacatgaaggag
ttgggtgaggagtccgccgagcagcacgcccgggtcggacgccacgccagcgagcgcggc
ctcgatgccgtgctgaccgtaggggaacagagtcgccacaccgcagatgccgcggctggc
cgacatttcgataacaaggcgtcgttgtttgaagtgcttgcgcaaatgataaatacacat
caagaaatcgccatcctggtcaagggtgcccgcggctcccgcatggaagatatcgtcgag
atggtcaaagaccgtcaggagtcagccacatgctag

DBGET integrated database retrieval system