KEGG   Aeromonas hydrophila YL17: AI20_06420Help
Entry
AI20_06420        CDS       T03186                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ahd  Aeromonas hydrophila YL17
Pathway
ahd00473  D-Alanine metabolism
ahd01100  Metabolic pathways
ahd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ahd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AI20_06420
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AI20_06420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahd01011]
    AI20_06420
Enzymes [BR:ahd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AI20_06420
Peptidoglycan biosynthesis and degradation proteins [BR:ahd01011]
 Precursor biosynthesis
  Racemase
   AI20_06420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHV34833
LinkDB All DBs
Structure
PDB: 

Position
3973884..3975110
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLILGLLAGQAVAAPYLPLASDHRNGEVQTASNAWLEVDLGAFEHNIQTLKD
RLGDKGPKICAIMKADAYGHGIDLLVPSVVKAGIPCIGIASNEEARVAREKGFTGRLMRV
RAATPDEVEQALPYKMEELVGSLVSAQGIADIAQRHHTNIPVHIALNSAGMSRNGIDLRL
ADSKEDALAMLKLKGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLEVPDAYFDMVRPGGLLYGDSIPSYTEYKRVMAFKTQVASVNHYPAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLIQGQKVPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGEAEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaagacactgctggccaccctgatcctgggcctgctggccggtcaggccgtc
gcagccccctatctgccgctcgccagcgatcaccgcaacggcgaagtgcagaccgccagc
aatgcctggctggaagttgatctcggcgccttcgagcacaacatccagaccctcaaggat
cgcctcggcgacaaggggccgaagatctgcgccatcatgaaggcggacgcctacggccac
ggtatcgacctgctggtcccctcggtggtcaaagccggcatcccctgcatcggcatcgcc
agcaacgaagaggcccgtgtggcgcgcgagaagggcttcaccggccgcctgatgcgagtg
cgtgccgctaccccggatgaggttgagcaggccctgccctacaagatggaagagctggtt
ggcagcctggtgagtgcccagggcatcgccgacatcgcccagcgccaccacaccaatatc
ccggtgcatatcgcgctgaactccgccggcatgagccgcaacggcatcgatctgcgtctg
gctgattccaaggaagacgcgctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagatgggtctggcccagttc
aagctggactcccagtggctgctggaagcgggcaagctggatcgcagcaagatcaccatc
cacgccgccaactccttcgccaccctggaagtgccggacgcctacttcgacatggtgcgc
ccgggcggcctgctgtacggtgactccatcccctcctacaccgagtacaagcgggtgatg
gcgttcaagacccaggttgcctccgtcaaccactacccggccggcaacaccgtcggttat
gaccgcaccttcaccctcaagcgcgactcctggctcgccaacctgccgctgggctactcc
gacggctatcgccgggcgctgagcaacaaggcctatgtgctgatccagggccagaaggtg
ccggtggtgggcaagacctccatgaacaccatcatggtggacgtgaccgatctgaagggg
gtcaaacccggtgacgaggtggtgctgttcggccgccagggtgaggccgaggtgaaacag
gcggatctggaggagtacaacggcgccctgctggcggacatgtacaccatctggggttac
accaaccccaagaagatcaaacgctaa

DBGET integrated database retrieval system