KEGG   Aeromonas hydrophila YL17: AI20_10475Help
Entry
AI20_10475        CDS       T03186                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ahd  Aeromonas hydrophila YL17
Brite
KEGG Orthology (KO) [BR:ahd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AI20_10475
Enzymes [BR:ahd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AI20_10475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin2_C
Motif
Other DBs
NCBI-ProteinID: AHV35595
LinkDB All DBs
Position
3032360..3033022
Genome map
AA seq 220 aa AA seqDB search
MIDFYTAATPNGFKVAIALEELGLPYRVIALDLSALDQKKPEFLAINPNGRIPAIVDRDN
GDFAVFESGAILLYLAEKAGKLLPADPKRRSQAIQWLMFQMGGVGPMMGQANVFYRYFPE
KIPAAIERYQKEGRRLFEVLDSHLAQHEYLADEYSIADIATWPWVRIYDWSGISIEGLPH
LQAWMDRMADKPACQKGITIPPRNEKPEDLVKQAQQMVTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttttataccgccgccaccccgaacggcttcaaggtggcgattgcccttgaa
gagctgggcttgccctaccgtgtcattgcgctcgacctgtcggcgctggatcagaagaaa
cccgagtttctggccatcaaccccaacggccgcattccggccatcgtcgatcgggacaac
ggggacttcgcggtgttcgagtcgggtgcgattcttctctatctggccgagaaggcaggc
aagctgctgccagcggaccccaagcgccgctcccaggccattcagtggttgatgttccag
atgggtggggtcgggcccatgatggggcaggccaacgtcttctatcgctacttcccggag
aagatcccggccgccatcgaacgctatcagaaggagggacgccggctgttcgaggtgctc
gacagccatctggcccagcacgagtatctggccgacgagtacagcatcgccgacatcgcc
acctggccctgggtgcgtatctatgactggagcggtatctccatcgaggggctgccccat
ctgcaggcctggatggaccggatggctgacaagccggcctgccagaaggggatcaccata
ccgccgcgcaacgagaagccggaagatctggtcaaacaggcccagcagatggtaacgcgt
tga

DBGET integrated database retrieval system