KEGG   Aeromonas hydrophila YL17: AI20_12120Help
Entry
AI20_12120        CDS       T03186                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ahd  Aeromonas hydrophila YL17
Brite
Enzymes [BR:ahd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AI20_12120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHV35908
LinkDB All DBs
Position
complement(2661997..2662581)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAINALEPHISQETLEYHHGKHHNTYVVNLNNLVPGTEFEGKSLEEIIKTS
TGGIFNNAAQIWNHTFYWHCLSPNGGAEPTGALADAITKAFGSFAEFKDAFTKSAIGNFG
SSWTWLVKKADGSLAIVNTSNAGCPLTEAGTTPLLTVDLWEHAYYIDFRNLRPKYMETFW
ALVNWEFVAKNLAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaacttcccgctctgccctatgcaatcaatgctctggaaccgcacatctcc
caggaaactctggaataccaccacggcaagcaccacaacacctacgtggtcaacctgaac
aacctggtgccgggtaccgagtttgaaggcaagtctctggaagagatcatcaagacctcc
actggtggcatcttcaacaacgccgcccagatctggaaccacaccttctactggcactgc
ctctccccgaacggcggtgccgagcccactggcgccctggccgatgccatcaccaaggcg
ttcggctccttcgccgagttcaaggatgcgttcaccaagtctgccatcggcaactttggc
tccagctggacctggctggtgaagaaggctgacggctccctggccatcgtcaacacctcc
aacgccggttgcccgctgaccgaagccggtaccaccccgctgctgaccgtcgacctgtgg
gagcacgcctactacatcgacttccgcaacctgcgtccgaagtacatggaaaccttctgg
gccctggtcaactgggaattcgtggccaagaacctggctgcctga

DBGET integrated database retrieval system