KEGG   Aeromonas hydrophila YL17: AI20_16385Help
Entry
AI20_16385        CDS       T03186                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ahd  Aeromonas hydrophila YL17
Pathway
ahd00620  Pyruvate metabolism
ahd00680  Methane metabolism
ahd01100  Metabolic pathways
ahd01120  Microbial metabolism in diverse environments
ahd01200  Carbon metabolism
Module
ahd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ahd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AI20_16385
  09102 Energy metabolism
   00680 Methane metabolism
    AI20_16385
Enzymes [BR:ahd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AI20_16385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHV36702
LinkDB All DBs
Position
complement(1741348..1743981)
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALRANVGMLGQLLGKSIKDHQGQAFLDKIETIRQLAKSSRKGNETDRERLLDTL
RNLSDDELLPVARAFSQFLNLANVAEQFHTISRRCEEQVCTPDPLEQMFDKLKASNLSQE
AIIQAVRELDIDLVLTAHPTEVTRRTLIHKHVQLNDCLEALELSDLLPRERDKILNRIEQ
LVNQAWHTNEIREQRPTPVDEAKWGFAVVENSLWPAIPEFMRNLDERLQHHLGVRLPLDA
APVKFTSWMGGDRDGNPFVTAKVTAEVLELGRWMAVSLFYKDIKELTSELSMSDCTDAVR
ERVGDHPEPYRALVRELREQLRETQEFLTAKVQGQASESRDLVKTTAQLREPLELCYHSL
HACGMGNIADGMLLDVLRKLACFGIHLVKLDIRQDGERHGQVFSELTRYLGMGDYAEWSE
DDKQAFLLNELNSRRPLIPSDWAPSDETRETLDTCKVIAQHDPDAFGIYIISMAGAPSDV
LAVQLLLKEAGCKFRMPVAPLFETQEDLMAGTAVMERLLSVDWYRGYIQGRQYVMIGYSD
SAKDAGMMAAGWAQYAAMESLVALAEANNLRLTLFHGRGGTVGRGGAPAHQAILSQPPGS
LRGGLRVTEQGEMIRFKFGLPKVAIQSLNLYTSAVLEGNLLPPPKPKECWRAVMEQLASV
SCDHYRSIVRGHPDFVPYFRAATPEMELGKLPLGSRPSKRKPNGGVESLRAIPWIFAWTQ
NRLMLPAWLGAHKGLQQAIADGQKGVLEEMSRQWPFFRTRLEMLEMVFLKADVWLAEYYD
TRLVPKELWGLGKQLRQELADSIQVVLELRPQGDLLDDQPWIKESIKLRNPYTDPLNVLQ
VELLGRSRNHPETLHPELDQALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaagtacgccgcactacgcgccaacgtaggcatgctgggtcaactgctgggc
aagtccatcaaggatcatcagggacaggccttcctcgacaagatcgaaaccattcgccag
ctggccaaatcctcccgcaaaggcaatgagacggaccgggaacgtctgctcgacaccctg
cgcaacctgagcgacgacgagctgctgccggtggcccgcgccttcagccagttcctcaac
ctggccaacgtggccgaacagttccacaccatctcccgtcgctgcgaagagcaggtctgc
accccggatccgctcgagcagatgttcgacaagctgaaagcctccaacctgtcgcaggag
gccatcatccaggccgtgcgcgagctggacatcgatctggtgctgaccgcccaccccacc
gaggtgacccgtcgcaccctgatccacaagcacgtgcagctcaacgactgcctcgaggcg
ctggaactctccgatctgctgccccgcgagcgggacaagatcctcaatcgcatcgaacag
ctggtcaaccaggcctggcacaccaacgagatccgtgaacagcgcccgaccccggtggac
gaggccaagtggggcttcgccgtggtggaaaacagcctgtggccggccatccccgaattc
atgcgcaatctggacgagcggctgcaacaccacctgggtgtgcggctgccgctggatgcc
gcgccggtcaagttcacctcctggatgggcggtgaccgcgacggcaaccccttcgtcacc
gccaaggtgaccgccgaagtgctggagctgggccgctggatggcggtgagcctgttctac
aaggacatcaaggagctcacctccgagctctccatgtccgactgcaccgacgccgtgcgc
gaacgggtcggcgatcaccctgagccctaccgcgccctggtacgcgagctgcgcgaacag
ctgcgcgagacccaggagttcctgaccgccaaggtgcagggccaggcgagcgagagccgg
gatctggtcaagaccaccgcccagctgcgcgagccactggagctctgctaccactctctg
cacgcctgcggcatgggcaacatcgccgacggcatgctgcttgacgtgctgcgcaagctg
gcctgcttcggcatccacctggtcaagctggacatccgccaggatggcgagcgccacggc
caggtcttctccgagctgacccgctacctcggcatgggcgactacgccgagtggagcgag
gatgacaagcaggccttcctgctcaacgaactcaactcccgccgcccgctcatcccgagc
gactgggcgccgagcgacgagacccgcgagaccctggatacctgcaaggtcatcgcccag
cacgaccccgatgcgttcggcatctacatcatctccatggctggcgcaccgtccgacgtg
ctggcggtgcagctgttgctcaaagaggccggctgcaagttccgcatgccggtcgccccg
ctgttcgagacccaggaagacctgatggcgggcaccgccgtgatggagcgcctgctgtcg
gtggactggtatcgtggctacatccagggccgtcagtacgtgatgatcggctactccgac
tccgccaaggacgcgggcatgatggccgccggctgggcccagtacgccgccatggaatcc
ctggtggcactggccgaggccaacaatctgcgtctcaccctgttccatggccgtggcggt
accgtcggccgtggtggtgcacctgcccatcaggccattctgtcgcaaccgccgggatcc
ctgcgcggtggcctgcgggtgactgaacagggcgagatgatccgcttcaagttcggcctg
ccgaaggtggccatccagagcctcaacctctacaccagcgccgtgctggaggggaacctg
ctgccgccgcccaagcccaaggagtgctggcgcgccgtgatggagcagctggcctctgtc
tcctgcgatcactaccgcagtatcgtgcgcggtcatccggacttcgtgccctacttccgc
gccgccaccccggagatggagctcggcaagctgccgctcggctcacgcccctccaagcgc
aaacccaacggcggggtcgagagcctgcgcgccatcccctggatcttcgcctggacccag
aaccggctgatgctgccggcctggctcggtgcccacaagggactgcagcaagccatcgcc
gacggccagaagggcgtgctggaagagatgagccgccaatggcccttcttccgcacccgc
ctcgagatgctggagatggtgttcctcaaggctgacgtctggctggccgagtactacgac
acccggctggtgcccaaagagctgtggggcctcggcaaacaactgcgtcaggagcttgcc
gactccatccaggtggtgctggagctgcgtccgcagggcgacttgctcgacgaccagcct
tggatcaaggagtccatcaagctgcgcaacccctacacagacccgctcaacgtgctgcag
gtcgagctgctgggccgctcgcgcaaccacccggagaccctgcatcccgagctggatcag
gcgctgatggtcaccatcgccggcatcgccgcaggtatgcgcaacacgggttga

DBGET integrated database retrieval system