KEGG   Arcanobacterium haemolyticum: Arch_1092Help
Entry
Arch_1092         CDS       T01242                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00473  D-Alanine metabolism
ahe00550  Peptidoglycan biosynthesis
ahe01100  Metabolic pathways
ahe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ahe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Arch_1092
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Arch_1092
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Arch_1092
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ahe01011]
    Arch_1092
Enzymes [BR:ahe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Arch_1092
Peptidoglycan biosynthesis and degradation proteins [BR:ahe01011]
 Precursor biosynthesis
  Amino acid ligase
   Arch_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 Chal_sti_synt_C ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ADH92806
UniProt: D7BPF7
LinkDB All DBs
Position
complement(1229537..1230655)
Genome map
AA seq 372 aa AA seqDB search
MSNSKIRVAVIYGGASGEHSISIATAGAVMRSLDPERYDVLPIGITRDGAWVPGATDASQ
LTLEAGLLEVEAAPEAVTLPAGDGTQSLVRYDRENASDLALLGNVDVVFPLLHGPFGEDG
TIQGMLEMAGVPYVGCGVFASAAGMDKHYMKVVLEAAGLPVAPYVVATARKWRDERDQVL
ADVAKMSFPVYVKPARAGSSLGITRVARIEDVPAAVAAAQIHDPKVLIEQGVNGREIECA
VLGGRGDTTPRASVVGEVLVNLPEDGFYDFEHKYLDTDGLTMSIPANVPEEISEKIRAQA
IATFDAFGCEGMSRVDFFLTPEGETFVIELNTIPGFTPFSMYPVLWENTGLPYSQLLDEL
IALALERPTGLR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattcaaagatccgcgttgccgttatctacggcggtgcctcaggtgaacactca
atttctatcgctaccgctggtgcggttatgcgatctctcgatccggaacgctatgacgtt
ctcccaattggtatcacacgcgatggcgcgtgggtgccaggagcaacggacgcaagccaa
ctcaccctagaagcgggtctgcttgaagtggaagcagcccccgaagctgttacgttgcct
gccggtgatggtacgcaatcgcttgtccgttacgatcgtgaaaatgcttctgatcttgca
cttttgggcaatgtggacgtggtattcccgcttcttcacggcccatttggtgaagacgga
actatccaaggaatgctggaaatggccggcgtaccatacgttggctgtggcgtgttcgca
tcggctgccggcatggataagcattacatgaaggttgtgctggaagctgccggtttgcca
gttgctccttacgtagttgcaactgcgcgcaagtggcgtgatgaacgtgaccaggtattg
gccgatgttgcgaaaatgtcattccctgtttacgtgaagccggcgcgcgctgggtcatcg
ttgggaatcacccgcgttgcacgaatcgaagatgttcctgccgccgtggctgccgcacaa
atccacgatccaaaggtgcttatcgaacaaggcgtgaatggccgagaaatcgaatgtgct
gtgcttggcgggcgtggcgataccactccacgcgcatccgttgttggcgaagtccttgtg
aaccttccagaagatggattctacgattttgagcacaagtacttggatacggacgggctc
accatgtcgatccctgcgaacgtgccagaagaaatctctgaaaagattcgcgcccaggct
atcgccacgtttgacgcgttcggctgtgaaggcatgtctcgtgttgatttcttcctcacc
cctgaaggcgaaacgttcgtgatcgaactcaacactattccaggtttcacgccgttctcc
atgtatccagttctgtgggaaaacacaggattgccatattcacaacttcttgatgaattg
attgcgttggcgctcgaacgcccaaccggtttgcgatag

DBGET integrated database retrieval system