KEGG   Arcanobacterium haemolyticum: Arch_1322Help
Entry
Arch_1322         CDS       T01242                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ahe  Arcanobacterium haemolyticum
Brite
KEGG Orthology (KO) [BR:ahe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Arch_1322
Enzymes [BR:ahe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Arch_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_3 GIDA FAD_oxidored Glutaredoxin FAD_binding_2 HI0933_like K_oxygenase Thi4 NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADH93025
UniProt: D7BK45
LinkDB All DBs
Position
complement(1464705..1466249)
Genome map
AA seq 514 aa AA seqDB search
MFLDSNTIAQLKGLVTNVKMPIRFEASLDDTKRSEQMREMLTQVAELSPMIEFAEVANER
TPSFAISRVDSDVSVRIAGLPMGEEFSSFVLALVQVGGHPVREDEDLIESIKNLSEPHEF
VTYMSLTCQNCPTVVQALNAMSVINPLIKHTAVEGGAFQDEVNARGIKAVPAVYMDGELF
GQGRMSLAEIVAKLDSNSGSKRAEKLNAAEPFDMLIVGGGPAGASAAVYAARKGLRVGVA
THNVGGQVLDTASIENLTVLEKIGGTELGGELAQSMANYSVEVMSGLIATKLNDKAEDGL
FTVEFDGDVRLKAKSVVLSTGARYRTTGVPGEAEYRNNGVSFCPHCDGPLFKGKPVGVIG
GGNSAIEAAIDLAGICSHVTVVELMPGLKADEVLLEKLSSLPNVTVHTSAALESVEGDGS
EMTSLTFKDSDGELQRVEANGMFVQIGLIPNAEWLNGTLEMNRGAVVVDQRNATSMPGVF
AAGDVTDIPYKQVLISLGAGANASLSAFDYLIRQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgattccaacacgatcgctcagcttaaaggactggtaacaaacgttaagatg
ccgatccgtttcgaagcgtcgctagacgatacgaaacgctccgagcagatgcgtgaaatg
ctcacacaggttgcggaactctccccaatgattgagtttgctgaagtagcaaatgaacgc
acgccgtcgttcgctatttcgcgcgtggattcggatgtttctgttcgaatcgcgggtctc
ccaatgggcgaagaattctccagcttcgtgctggcgcttgttcaagttggtggccaccct
gtccgtgaggatgaggatctcatcgaatcgatcaagaacctgagcgaaccacacgaattc
gtcacctacatgtctctgacctgccagaactgcccaacggttgttcaggcgttgaacgcg
atgtcagtgattaacccgctgatcaagcacacggcagttgaaggtggcgccttccaggac
gaagtcaacgctcgtggtatcaaggctgtgccagcggtttacatggatggtgaactgttt
ggccagggtcgtatgagtttggctgaaatcgtggcgaagctcgattcgaactctggttcg
aagcgagctgaaaagctcaatgcggccgaaccgttcgatatgttgattgttggcggtggc
ccggctggtgcgtcggctgcggtttatgcggcgcgtaagggcttacgtgttggtgtggct
acgcacaatgttggcggtcaggtgctggatacggcgtcgattgaaaacctcacggttctc
gaaaagatcggcggtactgagctgggtggcgaacttgcgcagtcgatggcgaactacagc
gttgaggtgatgagcggtcttatcgctacgaagctcaacgacaaggctgaagatggcctg
ttcaccgttgagtttgacggcgatgttcgcctgaaggctaagtcagtcgtgttgtctact
ggcgctcgctatcgcaccactggtgttccaggcgaagccgagtatcgcaacaatggcgtg
agcttctgcccgcactgtgatggtccgttgtttaagggcaagccggttggcgtgattggt
ggcggtaattccgcgatcgaagcagcgattgatcttgcgggtatttgttcgcatgtgact
gttgttgaattgatgccggggctgaaggctgatgaggttctcttggagaagctttcatcg
ttgcctaacgtgacggttcatacgtctgccgcgttggagtcggttgaaggtgatggttcg
gaaatgaccagtttgactttcaaggattccgacggcgaactccagcgtgtcgaagccaac
ggcatgttcgttcagatcggtttgattccgaatgctgagtggttgaatggcacgcttgag
atgaaccgtggcgcggttgttgtggatcagcgtaacgctacgtccatgccaggcgtgttc
gctgctggtgacgtgacggatattccgtacaagcaggtgttgatttcgctgggcgcgggc
gcgaatgcttcgttgagcgcgttcgattacttgattcgtcagtga

DBGET integrated database retrieval system