KEGG   Actinoalloteichus hoggarensis: AHOG_05110Help
Entry
AHOG_05110        CDS       T04975                                 

Gene name
dgdA
Definition
(GenBank) 2,2-dialkylglycine decarboxylase
  KO
K00596  2,2-dialkylglycine decarboxylase (pyruvate) [EC:4.1.1.64]
Organism
ahg  Actinoalloteichus hoggarensis
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ahg01007]
    AHOG_05110 (dgdA)
Enzymes [BR:ahg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.64  2,2-dialkylglycine decarboxylase (pyruvate)
     AHOG_05110 (dgdA)
Amino acid related enzymes [BR:ahg01007]
 Aminotransferase (transaminase)
  Class III
   AHOG_05110 (dgdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASO18675
UniProt: A0A221VYR0
LinkDB All DBs
Position
complement(1133689..1135002)
Genome map
AA seq 437 aa AA seqDB search
MPTERAPADPARHLIRYSGSNPFLPEVIARAAGTSVFTEDGRELLDFTSGQMSAILGHSH
PAIVATVREQVAHLDHLHSSMLSGPVVELGRRLAESLPDPLDKALLLTTGAEANEAAVRM
AKLVTGRHEIVSFARSWHGMTLAAANATYSAGRKGYGPAAPGNFALPVPHRFHPDIVDAN
GELDWHRQLDLGFDLIDAQSCGSLAACLIEPILSSGGVIELPPGYLAALAEKCRERDMLL
ILDEAQTGLCRTGDWYAFEHDGVVPDIITLSKTLGAGLPLAAVLTSAEIEQRAYDRGFLF
FTTHVNDPLPAAVGNTVLDVLVRDRLDERARQLGARLRADLDGLAARHEVVGDVRGRGLL
LGMELVGDAVLGAGGADRLGAAVTRRCFELGLHMNIVALPGMGGIFRIAPPLTASDAEIA
RGVAVLDQALTDAAREL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccgagagagcccccgccgacccggcccgccacctcatccgctactcgggcagc
aaccccttcctgccggaggtcatcgcccgcgccgcgggcacctcggtgttcaccgaggac
ggccgcgaactgctcgacttcacctcaggccagatgagcgcgatcctcgggcactcgcat
ccggcgatcgtggcgacggtccgcgagcaggtcgcacatctggaccacctgcacagcagc
atgctgagcggtccggtcgtcgaactcggtcgacgactggccgagagtctgcccgacccg
ctggacaaggccctgctcctcaccaccggggcggaggcgaacgaggccgcggtgcggatg
gcgaagctggtcaccggcaggcacgagatcgtctcgttcgcccggtcctggcacgggatg
acgctggccgccgcgaacgccacctacagcgcgggacgcaagggctacggaccggccgcg
ccggggaacttcgcgctgcccgtcccgcaccgcttccaccccgacatcgtcgacgcgaac
ggcgaactcgactggcaccgccagctcgacctcggcttcgacctgatcgacgcccagtcg
tgcggcagcctcgccgcctgcctgatcgagccgatcctcagctccggcggcgtcatcgaa
ctcccgccggggtacctcgccgcgctcgccgagaagtgtcgggaacgcgacatgctgctg
atcctcgacgaggcgcagacggggctgtgccgcaccggcgactggtacgccttcgagcac
gacggcgtcgtgcccgacatcatcacgctctcgaagacactcggcgcgggactcccgttg
gcggccgtgctgaccagcgcggagatcgagcagcgggcgtacgaccgcggcttcctgttc
ttcaccacccacgtcaacgacccgctgcccgccgccgtcggcaacaccgtcctggacgtc
ctggtccgcgaccgcctcgacgagcgggcgcggcagctcggcgctcggctgcgggccgat
ctcgacggcctcgccgcccggcacgaggtcgtcggggacgtccgaggccgaggcctcctg
ctgggcatggagctggtcggcgacgcggtcctgggcgcgggcggcgcggatcggctcggc
gcggccgtcacccgccgctgtttcgagctcggtctgcacatgaacatcgtggcgctgccg
ggaatgggcggcatcttccggatcgcgcccccgttgacggcgagtgacgcggagatcgcc
cgcggcgtcgccgtcctcgatcaggcgctcaccgacgcggcgcgggagctgtga

DBGET integrated database retrieval system