KEGG   Actinoalloteichus hoggarensis: AHOG_06845Help
Entry
AHOG_06845        CDS       T04975                                 

Definition
(GenBank) Extracellular serine proteinase precursor
Organism
ahg  Actinoalloteichus hoggarensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8 Inhibitor_I9
Motif
Other DBs
NCBI-ProteinID: ASO19017
UniProt: A0A221VZS3
LinkDB All DBs
Position
1528713..1529984
Genome map
AA seq 423 aa AA seqDB search
MVHHERRRWAACLSAVTVGLVIGTASAHGAAVDEGTVAQRAGAESASPRASDEGVGATAP
GDIRASASPTAIEDSYLVVLPETVAPESVDTAVESLIGVYGGTLRHTFEHAVRGFSVELD
SEAARLLAADPAVAYVEQNQRVSIHDTQQDPTWGLDRIDQRELPLDDSYTYGNTAAGVAA
YVIDTGVQPTHVEFGGRAVAAFDSVGDGQDGVDCNGHGTHVAGTIGGTEFGVAKEVAVHG
VRVLDCGGSGTIEGVLQGIEWVTANAEGPSVANMSLGGGVSDVLDEAVEESIASGITYVV
AAGNDAQDACGTSPARTPAALTVAASDEADVRASFSNLGECVDLFAPGLNITSAWIGSDD
AIDVISGTSMASPHVAGAVALFLESAPEATPAEVAEATLAHATVDVITEAGEGTPNLLLY
TGD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaccacgaacggaggcgatgggccgcttgcctgagtgcggtgacggtcgggctg
gtgatcggcacggcgagcgcgcacggcgccgctgtggacgagggaacggtggcgcagcgg
gcaggcgccgagtcggcgagtccccgagcatcggacgagggagtcggagcgaccgcgccc
ggcgacatccgcgcgtcggcctccccgacggcgatcgaggacagctacctggtggtgctg
cccgagacggtggcgccggagtcggtggacaccgccgtggaatcgctgatcggggtctac
ggcgggacgctgcgccacaccttcgagcatgccgtccgcggcttctccgtcgaactcgac
tcggaggcggcccgactgctcgcggccgaccccgcggtcgcctacgtcgagcagaaccag
cgcgtctccatccacgacacccagcaggaccccacgtggggactcgatcggatcgaccag
cgcgagctgccgctcgacgactcctacacctatggcaacacggcggccggggtcgccgcg
tacgtgatcgacaccggcgtccagccgacgcacgtcgagttcggcggccgggcggtcgcg
gccttcgactcggtgggcgacggtcaggacggcgtcgactgcaacggccacggcacccac
gtggcgggcacgatcggcggcacggagttcggcgtcgccaaggaggtcgccgtgcacggc
gtccgggtcctcgactgcggcggctcgggcaccatcgagggagtcctccagggcatcgag
tgggtcacggcgaacgccgaggggccctcggtggcgaacatgagtctcggcggcggcgtc
tccgacgtgctggacgaggccgtcgaggagtcgatcgccagtggcatcacctatgtggtg
gcggcgggcaacgacgctcaggacgcctgcggcacctcgcccgcgaggacgcccgccgca
ctgaccgtggcggcgtccgacgaggccgacgtccgggcgagcttctccaacctcggcgag
tgcgtcgacctgttcgcccccgggctgaacatcacctcggcctggatcggctccgatgac
gcgatcgatgtgatcagcgggacgtcgatggcctcgccgcacgtcgcgggcgcggtggcc
ctcttcctggagtccgccccggaggcgacgcccgcggaggtcgccgaggcgaccctggct
cacgccaccgtcgacgtcatcacggaggcgggcgagggcacgccgaatctgctgctctac
accggcgactga

DBGET integrated database retrieval system