KEGG   Actinoalloteichus hoggarensis: AHOG_10975Help
Entry
AHOG_10975        CDS       T04975                                 

Gene name
davT
Definition
(GenBank) 5-aminovalerate aminotransferase DavT
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00250  Alanine, aspartate and glutamate metabolism
ahg00410  beta-Alanine metabolism
ahg00640  Propanoate metabolism
ahg00650  Butanoate metabolism
ahg01100  Metabolic pathways
ahg01120  Microbial metabolism in diverse environments
Module
ahg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AHOG_10975 (davT)
   00650 Butanoate metabolism
    AHOG_10975 (davT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHOG_10975 (davT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AHOG_10975 (davT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ahg01007]
    AHOG_10975 (davT)
Enzymes [BR:ahg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AHOG_10975 (davT)
Amino acid related enzymes [BR:ahg01007]
 Aminotransferase (transaminase)
  Class III
   AHOG_10975 (davT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASO19838
UniProt: A0A221W231
LinkDB All DBs
Position
2496567..2497820
Genome map
AA seq 417 aa AA seqDB search
MAQLSPLLKQATPVQVARGEGVYLYDHDGRRYLDFTAGIGVTSTGHCHPKVVAAAQQQVA
TLIHGQYTTVMHQPLLTLTERLSEVLPAGLDSLFYVNSGSEAVEAALRLSRQSTGRQNVV
VFQGSFHGRTFGAASLTTSGTKIRAGIGPLVPGVTVAPFPYAYRYGWSEKEAVDFALREL
DYLLVTAAPAADIAAFFVEPVLGEGGYVPAPPGFLAGLRERADRHGILLVFDEVQTGFGR
TGEFWGHQHFDVEPDILITAKGLASGFPLSAIAASTELMSRGLPGSQGGTYGGNAVACAA
AVATLDVILEEGLVENAARTGERLLAGSRRIAADYAAVGDVRGLGLMVASEFVNPDGSPA
PEIANRVHRTAADLGLLLLTCGPHGNVVRMIPPLVVDEAQIDQGLELWAKAVSSGLG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttgtcgccactgctcaagcaggcaactccggtgcaggtcgcccgaggagag
ggcgtctatctctatgaccacgacggtaggcgctatctcgacttcaccgccggaatcggc
gtcacgagcacgggacactgccatccgaaggtcgtcgcggccgcgcagcagcaggtcgcc
acgctgatccacggccagtacaccaccgtcatgcaccagccgctgctcacgttgaccgaa
cggctgagcgaggtgctccccgccgggttggactcgctgttctacgtcaactccggaagc
gaggcggtggaggcggccctgcgtctctcccgccagtcgaccggcaggcagaacgtggtg
gtgttccagggctccttccacggtcgaaccttcggtgccgcgtcgctgacgacctcggga
accaagatccgcgcaggcatcggaccgctcgttcccggcgtcaccgtggcaccgttcccc
tacgcctaccgctacggatggtccgaaaaggaggccgtcgacttcgcactgcgggaactc
gactatctcctcgtcaccgccgcccccgccgccgacatcgccgcgttcttcgtcgagccc
gtcctcggcgagggcggctacgtccccgccccgcccgggttcctcgccgggctgcgggaa
cgcgccgaccggcacgggatcctgctcgtgttcgacgaggtgcagaccggcttcgggcgg
accggcgagttctggggacatcagcacttcgacgtcgagcccgacatcctgatcaccgcc
aaggggctggccagcggcttcccgctgtccgcgatcgccgcgagcaccgagctgatgagc
cgaggcctgccgggctcgcagggcggaacctacggcggcaacgccgtggcctgcgctgcg
gccgtggcgaccctggacgtcatcctggaggagggactcgtcgagaacgcggctcggacc
ggcgagcggctgctggccggttcccgccggatcgcggccgattacgcggccgtcggcgat
gtgcgcgggctggggctgatggtggcctccgagttcgtgaacccggacggctcgcccgct
ccagagatcgcgaaccgagtgcatcggacggcggcggacctcggtctgctgctgctgacc
tgtggtccgcacggcaacgtggtgcggatgatcccgccgctggtcgtcgacgaggcacag
atcgatcaaggcctcgaactctgggcgaaggcggtgtcctccggactgggctga

DBGET integrated database retrieval system