KEGG   Actinoalloteichus hoggarensis: AHOG_12455Help
Entry
AHOG_12455        CDS       T04975                                 

Gene name
katE
Definition
(GenBank) Catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00380  Tryptophan metabolism
ahg00630  Glyoxylate and dicarboxylate metabolism
ahg01110  Biosynthesis of secondary metabolites
ahg01130  Biosynthesis of antibiotics
ahg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AHOG_12455 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AHOG_12455 (katE)
Enzymes [BR:ahg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     AHOG_12455 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ASO20134
UniProt: A0A221W326
LinkDB All DBs
Position
complement(2840788..2842962)
Genome map
AA seq 724 aa AA seqDB search
MAVSPEPEEHPVDPARGGDEKDADLASARVDPAGARLTTSQGVRVEHTDDSLTVGERGPT
LLEDFHAREKITHFDHERIPERVVHARGAGAYGYFQPYDDSLADHTVAEFLRDPSIRTPV
FVRFSTVAGSRGSADTVRDVRGFATRFYTRQGNYDLVGNNMPVFFIQDGIKFPDFVHAVK
PEPHNEIPQAQSAHDTFWDFVGLHPESLHVVMWLMSDRSLPRSYRMMQGFGVHTFRLVDA
AGVGTFVKFHWTPKLGTHSMIWEEYQRVAGNDPDFHRRDLWNAIEAGDHPEWELGVQLVP
ESDEFSFDFDLLDATKLIPEEIVPVLPVGRLVLDRNPDDFFAETEQIAFHTANLVPGIDF
TNDPLLQARNFSYLDTQLIRLGGPNFSQLPVNRPITPVHDNLRDGYGQQRIHLGRAPYHK
NSLDAGYPMVSSNAEGGFRHLQEKVEGHKIRTRSGSFADHHSQATLFWNSMSGWEREHIV
AAFRFELGKCTDRQVRERVVEHLDRISRELAERVAPGIGIATPTGPPPRTHTDASPALSQ
ENTVHDTVRTRTVAVLAADGVRGGLLRSLRSALTEMGMIVEVVAPQEGPLRAEENDEGHE
DGPVVTADRALPTMASVLYDAVLVADGAESVDTLRADGGAVHFVAEAVRHAKTVGALGAG
VQLLQTANLTGFRLAQPGEDLVSDQGVLTSGTTHDQTPTRFLTSFADSVAGHRVWTRNTT
GLPA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcggtctcgccggagccggaagagcaccccgtcgatcccgccagaggaggcgacgag
aaggacgcggatctcgcctcggcacgggtggaccccgccggcgcgaggctgaccacgagc
cagggcgtccgagtcgagcacaccgacgactccctgaccgtcggcgaacgcggaccgacc
ctgctcgaggacttccacgccagggagaagatcacccacttcgaccacgagcgcatccca
gaacgggtggtacacgcccgcggcgcgggcgcctacgggtacttccaaccgtacgacgac
tcgctggccgaccacactgtcgccgagttcctgcgcgacccctccatccgcaccccggtc
ttcgtccggttctccaccgtcgcgggctcccgaggctccgccgacacggtgcgcgacgtc
cgaggcttcgccacccgcttctacaccaggcagggcaactacgacctggtcggcaacaac
atgccggtgttcttcatccaggacggcatcaagttccccgacttcgtccacgccgtgaag
ccggagccgcacaacgagattccgcaggcccagtccgcccacgacaccttctgggacttc
gtgggcctgcaccccgagtcgctgcacgtcgtgatgtggctgatgtcggatcgatcgctc
ccacgcagctaccggatgatgcagggcttcggcgtccacaccttccggctcgtcgacgcc
gcgggagtcggcaccttcgtcaagttccactggacgccgaagctgggcacgcactcgatg
atctgggaggagtatcagcgcgtcgcaggcaatgatccggactttcaccgccgggacctc
tggaacgccatcgaggcgggtgatcacccggaatgggaactcggcgtccagctggtaccg
gagtccgacgagttctccttcgacttcgacctgctggacgcgacgaagctgatcccggag
gagatcgtccccgtgctgcccgtgggcaggctggtcctcgatcgcaacccggacgacttc
ttcgccgagaccgagcagatagccttccacaccgcgaatctcgtccccggaatcgacttc
accaacgacccactgctgcaggctcgcaacttctcctacctggacacccagctgatccgg
ctcggcgggccgaacttcagccagctccccgtcaaccggccgatcacccccgtgcacgac
aacctgcgcgacggatacggacaacagcgcatccacctcggccgcgccccttaccacaag
aacagcctcgacgccgggtaccccatggtgtccagcaacgccgaaggcggctttcgtcac
ctgcaggagaaggtcgaggggcacaagatccggacccgcagcgggagcttcgccgatcac
cacagccaggcgaccctcttctggaacagcatgtccggctgggaacgcgagcacatcgtc
gccgccttccgcttcgaactgggcaagtgcaccgatcggcaggtgcgcgagcgcgtcgtc
gaacacctggaccggatctcccgagaactggccgagcgagtcgccccgggcatcggcata
gcgacgccgacgggtccgccgcccaggacgcacaccgacgcctctccggcactcagccag
gagaacaccgtccacgacaccgtccgaacccgcaccgtcgccgtcctggcggccgacggc
gtgcgtggcggactgctgcgctcgctacgctccgcactgaccgagatggggatgatcgtc
gaggtcgtcgcgcctcaggagggcccgctgcgtgccgaggagaacgacgagggccacgag
gacggcccggtggtgacggcggatcgcgcgttgcccacgatggcgtccgtgctctacgac
gccgtgctggtcgccgacggagcggagtcggtcgacacgctgcgcgcggacggcggcgcg
gtgcacttcgtcgcggaggccgtccgacacgccaagacggtgggcgccctcggcgcgggg
gtgcaactgctgcagacggcgaacctgaccggcttccgcctcgcccaaccaggcgaggac
ctggtgtcggaccagggcgtcctcaccagcgggaccacgcatgaccagacgcctacgcgc
ttcctcacctccttcgcggactccgtggcggggcaccgagtgtggacgcggaacaccacg
gggctcccggcatga

DBGET integrated database retrieval system