KEGG   Actinoalloteichus hoggarensis: AHOG_15460
Entry
AHOG_15460        CDS       T04975                                 

Gene name
fdtB2
Definition
(GenBank) dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00523  Polyketide sugar unit biosynthesis
ahg01100  Metabolic pathways
ahg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ahg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AHOG_15460 (fdtB2)
Enzymes [BR:ahg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.106  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase
     AHOG_15460 (fdtB2)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: ASO20718
UniProt: A0A221W4E9
LinkDB
Position
complement(3605883..3607067)
AA seq 394 aa
MTVPFLDPGAAYAELRDDIDAAVHRVLTSGRYLLGPEIEAFEAEYAAYCGTRHCVAVGSG
CDALELALRALDIGPGHEVIVPAHTFIATWLAVSATGAVPVAVEPDERTYNLDPARLTEA
ITPRTRAIIPVHLYGQPADLDAVQAVARRHGLAVVEDAAQAHGARYRGARIGTRTTATAF
SFYPGKNLGALGDGGAVITDDEAVARRLRLLRNYGSTVKYRHEIKGTNSRLDEIQAAVLR
VKLPLLDEWNARRAAVARRYLTECAGLPGVTMPYVAPWADPVWHLFVIRSARRDRLARRL
AARGVGTLVHYPTPPHLSPAYAGSHPGEGSCPRAERISDEVLSLPMGPHLSEGHVDAVVA
ALHAAVREQADDPSDRRSAPTDGDPPDARAPASA
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgacggtgccgttcctcgacccgggcgcggcctatgccgaactacgggacgacatcgac
gccgcggtgcatcgggtgctgacctccggccgctatctgctcggacccgagatcgaggcg
ttcgaggccgagtacgccgcctattgcggaacacgacactgcgtggccgtcggcagcggc
tgcgacgccctggagctggcactgcgggcgttggacatcggccccggccacgaggtgatc
gtgcccgcccacaccttcatcgccacctggctcgccgtctccgcgaccggggccgtgccg
gtggccgtcgaaccggacgagcgcacctacaacctcgatccggcgcgcctgaccgaggcg
atcacgcccaggacgagggcgatcatcccggtacacctgtacgggcagcccgccgacctg
gacgccgtccaggccgtggcccgccgacacggcctggccgtcgtggaggacgcggcgcag
gctcacggcgcgcgataccggggtgcgcgaatcggcacgcggaccaccgcgaccgcgttc
agcttctatcccggcaagaacctgggcgcgctcggcgacggcggcgccgtgatcaccgac
gacgaggcggtcgcccggcgcctgcgcctgctgcgcaactacggctccaccgtgaagtac
cgccacgagatcaagggcaccaactcacgactggacgagatccaggccgccgtgctccgt
gtgaagctccccctgctggacgagtggaacgcccggcgggccgccgtcgcccggcgttat
ctgaccgagtgcgcaggcctgccgggcgtgaccatgccctacgtcgcgccgtgggcggac
ccggtctggcatctcttcgtgatccgcagcgcacgacgcgatcggctggcgcggcggctc
gccgcccgcggggtggggacgctcgttcactacccgacgcccccacatctgtcgcccgcc
tacgccggatcacacccgggcgagggttcctgtccccgcgccgaacggatctccgacgag
gtcctgagcctgccgatggggccgcacctgtccgaaggccacgtcgacgccgtcgtcgcc
gcgctgcacgccgcggtccgcgagcaggccgacgacccgtcggaccggcggagcgccccg
accgacggcgatccgccggacgcccgcgcgcctgcctcggcctga

DBGET integrated database retrieval system