KEGG   Actinoalloteichus hoggarensis: AHOG_15495Help
Entry
AHOG_15495        CDS       T04975                                 

Gene name
eryA9
Definition
(GenBank) Erythronolide synthase, modules 3 and 4
Organism
ahg  Actinoalloteichus hoggarensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR Ketoacyl-synt_C PS-DH PP-binding KAsynt_C_assoc adh_short Epimerase Thiolase_N Polysacc_synt_2 GDP_Man_Dehyd PKS_DE RmlD_sub_bind 3Beta_HSD NmrA NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ASO20725
UniProt: A0A221W4E6
LinkDB All DBs
Position
complement(3639041..3655639)
Genome map
AA seq 5532 aa AA seqDB search
MVRSSGVDRLPWTLSGSGAQSVRGQAGLLLAHLDATPDWRPVDVGHTLAQRPAAGPWRAA
LVAGEAADFRTGLRGLAAGHSAPGLVEGPRVGDSVAFVYSGQGSQWPGMARELSASSSVF
RARIEDCAQALEPFLDWSLLDLLRGAAPELPLDRADVAQPALFAVGAALTALWRSYGVEP
AAVAGHSLGEILAAEASGALSLDDAARVAALWSQAQVTLAGRGEMVSVRASRAEVTKLLR
PWGDALGVAAVNGPAAVIVSGDADAAAEFVAALHADGMTARPVAVGLAAHSAHIDDILPR
LRDDLAALRPREPELPFYSALHGSRLPEGERLDADYWCRNLRGTVRFDEATRAMLADGHR
VLLEMSPHPVLTAAMQEIVEAAEVTASVRGALRRDQADLGRVVHSLAELHVDGVGFDPSV
VFAGHGPLLDLPAVAEDAATDETVSPAEALASLSDGQRRTALLDLVRHEVAVTLGRADGR
LVDPSTPFRDLGFDSITAVEIRNRVGVATGLTLPYTLAFDHPTPAAVADHLHAEFFGVAD
VGDVPPAVSAGADDPVVIVGMACRFPGGVSTPEELWRLCADGVDVVSDFPADRGWDVAGA
YSPTIERPGQFYQGEAGFLHDADLFDAEFFGISPREALAMDPQQRLLLETSWEVLERTGI
DPASLRGSRTGVFIGAMTMDYGPRLDAASGHEGHLLTGNTGSVLSGRIAYTLGLEGPAVT
VDTACSSSLVALHLAVAAVRAGECTSALAGGATVMPSLGMFVEFSRHGGLAPDGRCKPFS
STADGFGLAEGVGLLLVERLSDARRLGHRVLAVVAGSAVNQDGASNGLTAPNGPSQQRVI
RQALASAGVGPSEVDVVEAHGTGTRLGDPIEAQAVLATYGQGRERPLLLGSVKSNLGHTQ
AAAGVAGVMKMVLAMRHGIVPPTLHLDEPSPQVDWSAGTVELVPEAVEWPSTGLRRAGVS
SFGISGTNAHVILAEPPGPVPVSEPTTESEPDESAAAHQPDRDTGRPVGTPAAVEPGAEP
TSTEPPRSEPTGIEQATAETARPDAARGETPEADIAEAGVEPASRDAAEVFSWVLTAKSA
SALRGQAERLLGFVRETDGDLADVAHSLVTTRSVFDHRAVVVGRDRGELTEGLAAIAAAR
SSAFAVTGSPVLGKSAVLFTGQGAQRAGMGRELYASEPVFAAAFDAVCAELDPRLDLPLR
EVVFSDDHELLAQTAWTQAALFAVEVALFRLVESWGVRPDVVGGHSIGEVVAAHVAGVLT
LADACTLVAARGALMQSLPAGGAMASLRASEEEVLPLMTAGVSIAAVNGPRSVVISGVEA
EVSALAARFEKSRRLRVSHAFHSPLMEPMLAEFSEVVRTLEFHAPRIPVLSDVTGGLAEP
EVVCDAAYWVRHVREPVRFADGVRTLQDTGVSVLLELGPAGVLSAMAAESLRAASVAVPS
LLPDRPEASALRMAAARLFALGVPIDRAVLGAAGRRITLPTYAFDRTRYWLEPRTAAAAG
ADGEFWDAVDREDLDALADSLDLGEEERAPLRELLPRLSSWRERGRRRSRVDGLRHRVVW
RPTRQASSARLTGSWVLVSGGDDEDVATALAAAGADVVRLAPTELSTGMPADCAGVVSTV
GLRDTLAVVQELGDRTTPLWCLTRDGVAAPGSDGPVEPWQAAVWGLGRVAALEHPRLWAG
LIDLPARPDEATLRRLAAVLADPAGEDQLALRSSGTFVRRLHRAPSTRGDGGLPTGTVLV
TGGTGALGAAVARLLARNGADRLVLTSRRGVDAPGAPDLAAELRAMHVDVDVVACDVADR
AAVADLLAAHPIDAVFHAAGEIADGVLATMTPERLDRPLAAKARGAAHLDELTRDRELSA
FVVFTSVTGVLGTAGQANYAAANAFLDALAERRRAEGLPGTAIAWGPWAGEGMAAGAVGA
RLAGDGLRPLSVPAALAALRNVLERDETGITVADVDWARFAAHFTATRPSPLLADLPEAA
APADDRGASVGPAALDAADRGRALLDLVRTESAAVLGHRSGADIDVHRVFKDLGFDSLTA
VALRNRMSAATGVTLSAAVVFDHPTPAALAAHLDREMTGRHPEDADAPPAVAEADDPVVI
VGMACRFPGDVRSPEDLWRLLSHGEDAIGEFPADRGWNLDDLYDPTAERAGTSYTRAGGF
LPDAADFDAAFFGISPREALAMDPQQRVLLETSWELFEHAGIRPAALRGERVGVFVGTNG
QDYVTDLAQLPPDVEGHALTGNTASVVSGRIAYTLGLEGPAVTVDTACSSSLVALHLAVQ
ALRGGECTAAIAGGVTVMSRPGVFVEFSRQRGLAPDGRCKSFAAAADGTGWSEGVGLLLV
ERLSDARRLGHRVAAVVRGSAVNQDGASNGLTAPNGPAQERVIRQALANAGLSAADVDVV
EAHGTGTRLGDPIEAHALLRTYGQDRERPLSLGSVKSNLGHTQAAAGVAGVMKMVLAMRH
GIVPPTLHVDEPTSQVDWSAGAVELVTEARPWQTDGRPRRAGVSSFGVSGTNAHVILEAP
PESSAAVPRRQAAGEPAASAVVPWVLTGTSAAAVRGQATRLAEFLRERPALSPVDVGTAL
AARSPFARRVLLAGADRTALLAALAEVAAGRTNLEQPSVGSGVVLVFPGQGSQWVGMAVG
LAAVSSVFAARLGECAEALSEFVDWSLPDVLGDEVALSRVDVVQPVLFAVMVSLAELWRS
VGVVPAAVVGHSQGEIAAAVVSGGLSLRDGARVVVSRSRLIAGLGGGGGMVSVSLPAAEV
VGLLPAGVSLAAVNGPSSVVVSGPRAALAELVADCESRNVRARWIPVDYASHSAAIEEIR
DELITVLAEIDPQPSTVPFYSSVTGAPRATETLDARYWFDNLRETVRFDRAVESLLSDGL
GVFVESSAHPVLTYGVQEVADGRADDQNTLVVGTLRRDDGGLDRFLASAGELFAHGIDLD
LTPFLTGGRLVELPTYAFQRRRYWLDTPATTGDVDAVGLDAADHPLLGATVPVAGTDGLI
HTGRISVAEQPWLADHVVDGAVILPGTAFVELLVRAGEPLGCTRLHELTLQTPMVVPDSG
ALRLQVVVGPSDDDGARPVGVHTRDTDDAAAHWTTHATGLLLPAPPQADFALTQWPPTGA
DPVDVEHVYGGFAEIGMHYGPVFQGLRRAWRRADEIFAEVVLTEEDGATAHRFGVHPALL
DAALHTFALAGIGPQEPILPFAWSDVRFFAAGGAALRVRVRRLGDDTMSIQVADAAGAPV
LSARSLTVRPATAARPGTARRDSLFRVEWLPATGGARRTPVSVIDCHERDPRTAVHRVLA
DLQARLAEDSDDRLVVLTRGAVAVTPEETPDLAGAAVWGLVRSAQAEHPGRIVLLDSDGT
ADPALSAALDEPQVAVRGEQPFVARLRRVSAEGAAAWTAAGPTLITGGTGTLGAAVARHL
VARHGVRDLVLVSRRGPAAPGALRLRDELVGLGAAVAVVACDVSERDQVARLLADHPVDA
VVHAAGTLDDGVVSALTPERVDAVFAAKADAAWHLHELAGELSAFVSFSSAAGVIGSAGQ
ANYAAANAFLDALARHRRAQGLPGQSLAWGLWSQTSEMTGALDAADVTRLQRAGIAPMST
EDGLARFDAALGVDDASPVPFRLDLTAFRHEVPRLFTDLVPARRRATPATATTLSERLAG
LDDTRATALLVDLVRAQAARVLGHATPEAVDTMQPFQLLGFDSLTAVELRNRLNDETGLR
LPATMVFDHPTPATLADFLRERLLGTAAAPAPEAPTTPLSDDPIVIVGMACRFPGGVTDP
DGLWRLLADGGEVVGDFPTDRGWDLDELYDPEPGVPGRSYTRAGGFLADAADFDAGFFGI
SPREALAMDPQQRLLLEASWEVIERAGVDPVSLRGSRTGVFTGLMYHDYASRLPRVPADV
EGYAGNGNAGSVASGRVAYALGLEGAAVTVDTACSSSLVALHLAAQALRAGECDLAIAGG
VTALATPGVFVEFSRQRGLSPDGRCKSFANAADGTGWSEGVGLLLVERLSDARRLGHRVL
AVVAGSAVNQDGASNGLTAPNGPSQQRVIRQALASAGVGPSEVDVVEAHGTGTRLGDPIE
AQAVLATYGQGRERPLLLGSVKSNLGHTQAAAGVAGVMKMVLAMHHGIVPPTLHVDEPTR
EVDWSAGAVELVTEARPWPIDGRPRRAGVSSFGVSGTNAHVILEAPPALAAAESDGDPAA
SDGDGDPTAPHGDPAAPPLVPWVLTGRSPAALRAQADRLARLLQDRPDLRPIDVGSSLAT
SRSLFDHRVLLTGSHRDDFAAALAEIAAGAVPSEERRAGSGVVLVFPGQGSQWVGMAVGL
AAVSSVFAARLGECAEALSEFVDWSLPDVLGDEAALSRVDVVQPVLFAVMVSLAELWRSV
GVVPAAVVGHSQGEIAAAVVSGGLSLRDGARIVVSRSRLIAGLGGGGGMVSVSLPAAEVV
DLLPAGVSLAAVNGPTSVVVSGSEQSLAELVADCESRNVRARWIPVDYASHSVLMDALRD
ELLDVLAGIEPRSSTVPFYSSVTGAAKDTASLDARYWFDNLRETVRFDRAVESLLSDGLG
VFVESSAHPVLTYGIGEVVEEHGAENVLVVGTLRRDDGGLDRFLASAGELFAHGVDLDLT
PFLTGGRLIDLPTYPFQRQRYWLDTPKGFAGDLTSIGQRDTDHPLLGAAVPLADSGGVVL
TGHVSIETHPWLADHAVAGTVLLPGTAFVELAVRAGDQVGCGRVEELTLEAPLVLPRHGA
LALHVLVGAQDDAGLRPVSVYSRRAADDTAWTCHAVGQLGADVPGRDLDLTAWPPAAATV
VPLDGLYERLHDRGYEYGPTFQGLRAMWRTEKEVYAEVTLPDDAITDSPAFDLHPALLDA
ALHPAGAAAATDDVRLPFSWSGVSVHAVGARSLRVRLTLRGEGVVSLDAADQTGASVVSV
ESLALRPVAPEQLAVASTDSLYQLDWSGPREINPSGAATGRWIGGADDLAAPPGESTPDV
LLLDAARAGTADTPARARRAVGTVLDVLRDWLADDDLADTRLAVVTRSAVRAVDDDVPDP
AAAAVWGLVRSAQTENPDRIVLLDVDEPADDRVLVAAAMTGGEQAAIRAGRLYLPQLVRG
GPAESAAPSWGPAGRVLITGGTGTLGAAVARHLVSRHGVRSLVLAGRRGPDAPGAAALRE
ELTGLGADVVVESCDLADRAAVARLLAAHPVTAIVHSAGVLDDGVVSALTPERVDAVFRP
KVDAAWHLHELAGEVSAFVLFSSASGVFGTAGQGNYAAANTFLDALAEHRRARGLPAHSL
AWGWWAATSELTARLGTADRTRLTRRGVVPLSTEEGLALFDAAVAGTRPVVLPVRLDLTA
TLPAVCRGLRRAARRTAAAPAAGEATLLDRLARLDRSDRDAALLNLVRTTAAAVLGHPTL
GEVRPARAFKDLGFDSLTAVELRNRLHRETGRRLPATLVFDYPTPQAIVGFLTDELFGTA
PAQSPVLADLDRLEAGLTDDLDEETRSTITSRLKAVIARWAGDAADGSFVDRLDTASDDE
IFSLIDNRLGRP
NT seq 16599 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtagttcgggtgtcgatcggctgccgtggacgttgtccggcagcggtgctcag
tcggtgcgcggccaggcgggactactgctcgcacacctggacgcgacaccggactggcgt
cccgtcgacgtcggccacaccctcgcccagcggcccgccgccgggccctggcgtgccgcg
ctcgtcgccggggaggccgccgacttccgcaccggactccgtggactggccgccgggcac
agcgcgcccggcctggtggaggggccccgggtcggggactccgtcgccttcgtgtactcc
ggacagggctcgcagtggcccggcatggcgcgggagctgtcggcgtcctcctcggtgttc
cgcgcgcgcatcgaggactgtgcccaggcgttggagccgttcctcgactggtcgctgctc
gacctgttgcgcggggcggctccggagcttccgctggatcgcgccgacgtcgcgcagccc
gccctgttcgcggtgggcgcggccctgacggcgctgtggcgttcctacggggtggagccc
gcggccgtcgcgggccacagcctcggcgagatcctcgcggccgaggcgtccggcgcgctc
tcgctcgacgacgccgccagggtcgcggcgttgtggagccaggcgcaggtgacgttggcc
gggcgcggcgagatggtgtcggtccgcgcctcccgcgccgaggtgaccaagctgctgcgt
ccctggggtgacgcgctcggcgtcgccgcggtgaacgggcccgccgccgtgatcgtctcc
ggtgacgccgacgccgccgccgagttcgtggccgccctgcacgcggacgggatgaccgcg
cgcccggtcgccgtcggcctggcagcgcactccgcgcacatcgacgacatcctgccgcgc
ctgcgtgacgatctggccgcgttgcgcccgcgggagcccgaactgccgttctactcggcg
ctgcacggctcccggctgcccgagggcgagcggctcgacgccgactactggtgccgcaac
ctccgcggcaccgtgcgattcgacgaggcgaccagggcgatgctcgccgacggccaccgg
gtgctgctggagatgagcccgcatccggtgctcaccgccgcgatgcaggagatcgtcgag
gccgccgaggtcaccgcgtcggtgcggggcgcgctgcggcgtgatcaggccgacctcggc
cgagtggtgcactcgctggccgaactgcacgtcgacggcgtcgggttcgatccctcggtc
gtgttcgcgggccacggcccgctgctcgacctgcctgccgtcgccgaggacgccgcgacc
gacgagaccgtgtcaccggccgaggcgctggcgtcgctgtccgacgggcagcggcggacc
gcgttgctggacctggttcgtcacgaggttgcggtgacgctgggccgtgccgacgggcgg
ctcgtcgatccgagcacgccgttccgcgatctcggcttcgactcgatcaccgcggtcgag
atccgcaaccgcgtcggcgtcgcgacgggactgaccctgccgtacaccctcgccttcgac
cacccaacccccgccgcggtcgccgaccacctgcatgccgagttcttcggcgtcgccgac
gtcggcgacgtcccgcccgcggtgtcggccggtgccgacgatccggtggtcatcgtcggc
atggcctgccgcttccccggcggcgtctcgacgccggaggaactgtggcggctgtgtgcc
gacggcgtcgacgtggtgtccgacttccccgccgaccgcggttgggacgtggcaggagcc
tattcgccgacgatcgagcgacccggccagttctaccagggcgaggcgggcttcctgcac
gacgcggacctcttcgacgcggagttcttcgggatctccccgcgtgaggcgctggcgatg
gacccccagcagcgcctgctgctggagacctcctgggaggtgttggagcggacgggcatc
gacccggcctcgctgcgcggcagccggaccggcgtgttcatcggcgccatgacgatggac
tacgggcctcgcctggacgccgcctccgggcacgagggccacctcctgacgggcaacacc
ggcagtgtcctctccggacgcatcgcctacacgctcggcctggagggcccggcggtgacc
gtcgacaccgcgtgttcgtcctcgctggtggcgctgcacctggcggtcgcggccgtgcgg
gcgggcgagtgcacctcggcgttggcgggcggggcgaccgtcatgccgagcctcggcatg
ttcgtggagttctcccgacacggcgggctcgcgccggacgggcgctgcaagcccttctcc
agcaccgccgacggattcggcctcgccgagggtgtgggtctgttgttggtggagcggttg
tcggatgcgcggaggctggggcaccgggtgttggcggtggtggcgggttcggcggtgaat
caggatggtgcgtcgaatgggttgacggcgccgaatggtccgtcgcagcagcgggtgatt
cggcaggcgttggcttcggcgggggtgggtccgtctgaggttgatgtggtggaggcgcat
gggacgggtactcggttgggtgatccgatcgaggcgcaggcggtgttggcgacctacggg
cagggtcgtgagcggccgttgttgttgggttcggtgaagtcgaatctgggtcatacgcag
gcggcggcgggtgtcgccggggtgatgaagatggtgctggccatgcggcacggcatcgtg
ccgcccaccctgcatctcgacgagcccagcccgcaggtcgactggtccgcgggcacggtg
gagctggtgcccgaggcagtcgagtggccgtcgacgggtctgcgacgggccggggtctcc
tcgttcgggatctccggcacgaacgcccacgtgatcctggcggaaccacccggaccggta
cccgtgtcggagcccacgacggagtccgagccggacgagtccgcggcggcacaccagccg
gaccgcgacaccggacgacccgtcggcaccccggcggccgtcgaacccggcgccgagccg
accagtaccgagcctcctcgatcggagccgaccggaatcgaacaggcgacggccgagacg
gcccggccggacgcggcccgaggcgagactcccgaggcggacatcgccgaagccggtgtc
gagcccgcctcccgcgacgcggccgaggtgttctcctgggtcctcaccgcgaagtcggcg
tcggcgctgcgcggccaggcggagcggctgctgggcttcgtgcgcgagacggacggcgat
ctcgccgacgtcgcgcactccctggtgacgacgcggtccgtgttcgaccaccgcgccgtc
gtcgtgggccgcgaccggggcgaactgaccgagggcctcgccgcgatcgccgccgcccga
tcctcggcgttcgcggtcaccggctcgccggtgctcgggaagtcggccgtgctgttcacc
ggccagggcgcccagcgagcgggcatgggccgggagctgtacgcgagcgagccggtcttc
gccgccgccttcgacgccgtctgcgccgaactggacccgaggctggacctgccgctgcgc
gaggtcgtcttctcggacgaccacgagctgctcgcccagaccgcctggactcaggcggcg
ttgttcgccgtcgaggtcgcactgttccggctcgtcgaatcgtggggggtgcgtcccgac
gtggtcggcggccattccatcggagaggtcgtcgcggcgcacgtcgcgggcgtgctgacg
ctcgcggacgcctgcacgctggtggccgcccgaggcgcgctgatgcagtcgctgcccgcg
ggcggcgcgatggcgtcgctgcgtgcgagcgaggaggaggtcctcccgctgatgacggcg
ggcgtgtcgatcgccgcggtgaacggaccgcgctcggtggtgatctccggcgtcgaggcc
gaggtgtcggcgctggccgcgcgtttcgagaagtcccggcgactgcgggtcagtcacgcc
ttccactcgccgctgatggagccgatgctggcggagttctccgaggtcgtgcggacactg
gagttccacgcgccccggattcccgtgctctccgacgtcaccggcggtctggcggagccc
gaggtggtgtgcgacgcggcgtactgggtgcggcacgtgcgcgaaccggtccgtttcgcc
gacggtgtgcgcaccctccaggacaccggcgtctcggtgctgctggagctggggccggcc
ggagtcctgtcggccatggcggcggagtcgctgcgggccgcctcggtcgccgtgccgtcg
ctgctgcccgaccgtcccgaggcgtccgcgctgcgcatggcggcggcgcgactcttcgcc
ctcggcgttccgatcgaccgggccgtgctgggcgcggcgggcaggcggatcacgctgccg
acgtacgccttcgatcgcacgcggtactggctggagccccggaccgccgccgcggccggc
gccgacggcgagttctgggacgccgtcgaccgagaagacctcgacgccctcgccgactcg
ctcgacctcggcgaggaggagcgggcaccgttgcgggaactgctgccgaggctgtcctcc
tggcgggagcgcggccggcgtcgatcccgagtggacggtctgcgccaccgggtggtgtgg
cggccgacgcggcaggcctcgtcggctcgactcaccggcagctgggtactggtctccggt
ggcgacgacgaggacgtcgccaccgcgctggcagccgcgggcgccgacgtcgtccggctc
gcccccaccgagctgagcacgggaatgcccgccgactgcgccggtgtggtgagcaccgtc
ggcctgcgggacaccctggcggtcgtccaggaactcggcgaccgcacgacgccgctgtgg
tgcctgacacgcgacggcgtggcggcccccggctccgacgggcccgtggaaccgtggcag
gcggcggtgtggggactcgggcgggtggccgcgctggaacaccctcggctgtgggccggg
ttgatcgaccttccagcccgccccgacgaggcgacgctgcgcagactcgccgccgtgctg
gccgaccccgccggagaggaccagctcgccctgcggtcgtccggcacgttcgtacggcgg
ctgcaccgggcgccgtcgaccaggggcgacggcggactgcccacgggcaccgtcctcgtc
accggcggcaccggggcgctcggcgccgccgtcgcccgcctcctcgcccgaaacggtgcc
gaccggctcgtcctgaccagccgccggggtgtcgacgctccgggcgcccccgacctcgcc
gccgagctgcgggcgatgcacgtcgacgtcgacgtggtggcctgcgacgtcgccgaccgc
gccgccgtcgccgacctgctggccgcacatccgatcgacgcggtgttccacgccgcgggc
gagatcgccgacggcgtgctcgccacgatgacccccgaacgactggaccgaccgctggcc
gccaaggctcggggcgccgcccatctcgacgagctgacccgagaccgagagctgtcggcc
ttcgtggtgttcacctcggtgaccggcgtcctcggcacggcggggcaggcgaactacgcg
gccgccaacgccttcctcgacgcgctcgccgaacgccgccgcgccgaagggctgcccggg
acggcgatcgcctggggaccgtgggccggggagggcatggcggcgggtgccgtcggcgcc
cggctcgcaggcgacgggctgcgtcccctgtcggtgcccgcggcccttgccgcgctgcgg
aacgtgctggagcgcgacgagaccgggatcaccgtcgccgacgtcgactgggcgcgattc
gccgcgcacttcaccgcgacccggccgagcccgctgctggcggacctccccgaggccgcc
gcaccggccgacgaccgcggcgcctcggtcgggcccgccgccctggacgcggccgaccgc
ggtcgtgccctgctggacctcgtgcgcaccgagagcgccgccgtgctcggccatcgctcc
ggtgccgacatcgacgtgcaccgcgtgttcaaggacctgggcttcgactccctgaccgcc
gtcgccctgcgcaaccggatgagcgccgcgacgggcgtgacgttgtcggcggccgtggtg
ttcgaccacccgacgcccgccgcgctggccgcccatctcgaccgggagatgaccggccgt
caccccgaggacgccgacgccccgcccgccgtggcggaggcggacgaccccgtggtgatc
gtcggcatggcctgccggtttcccggcgacgtgcgctctcccgaggacctgtggcggctg
ctgtcgcacggcgaggacgcgatcggcgagttccccgcggaccgcggctggaacctcgac
gacctctacgacccgaccgccgaacgcgccgggacgagttacacccgcgcgggcgggttc
ctgcccgacgccgccgacttcgacgccgccttcttcggcatctcgcctcgggaggcgttg
gcgatggacccgcagcagcgtgtgctgctggagacgtcctgggagctgttcgagcacgcg
gggatccgcccggccgccctgcggggcgaacgggtcggagtgttcgtcggcaccaacgga
caggactacgtcaccgacctcgcgcagctcccacccgacgtcgaaggacacgcgctgacc
ggcaacaccgccagtgtcgtgtccggccgcatcgcctacacgctcggcctggaggggccc
gcggtcaccgtcgacacggcatgctcgtcgtcgttggtggcgctgcacctggccgtgcag
gcactgcgcggcggcgagtgcaccgccgccatcgccggcggcgtcaccgtcatgtcccgg
cccggcgtgttcgtggagttctcccggcagcgcgggctggccccggacggccgctgcaag
tccttcgccgccgcggccgacggcaccgggtggtccgagggcgtcggcctgctgctggtg
gagcggctgtccgacgcgcggcgtctcggccaccgggtggccgcggtggtgcgcggttcc
gcggtgaatcaggacggcgcctccaacggactcaccgcgccgaacgggccggctcaggaa
cgggtgatccgacaggcgttggcgaacgcgggactgtccgcggccgacgtcgacgtcgtg
gaggcccacggcaccggaacccgtctcggcgaccccatcgaggcccacgccctgctgcgc
acctacgggcaggaccgggagcggccgttgtccctggggtcggtgaagtcgaacctcggg
cacacacaggcggcggccggtgtcgcgggcgtcatgaagatggtgctggccatgcgccac
ggcatcgtgccgcccaccctgcatgtggatgagccgacgtcgcaggtggactggtcggcc
ggtgcggtggagttggtcaccgaggcgcggccctggcagaccgacggccggccgcgtcgt
gcgggggtgtcgtccttcggggtcagcggcaccaacgcccacgtcatcctggaggcgccg
cccgagtcctcggccgccgtgcctcggcggcaggcggccggggagcccgccgcctcggcg
gtggtcccgtgggtgctcaccggcacgtcggcggccgccgtgcgcggccaggccactcgg
ctcgcggagttcctgcgtgaacgccccgcgctgtccccggtggacgtcgggaccgcattg
gcggcgcgatcgcccttcgcgcggcgggtgctgctcgccggggcggaccgaaccgcactg
ctggcagccctggccgaggtggccgcgggccgaacgaacctcgaacagccctcggtcggc
tcgggtgtggtgttggtgtttccgggtcagggttcgcagtgggtggggatggcggtgggg
ttggcggcggtgtcgtcggtgttcgctgctcggctgggtgagtgtgccgaggctttgtcg
gagttcgtggactggtcgttgcctgatgtgttgggtgatgaggttgctctgtcgcgggtt
gatgtggtgcagccggtgttgttcgcggtgatggtgtcgttggcggagttgtggcgttcg
gtgggggtggttcctgctgcggtggtggggcattcgcagggtgagatcgcggcggcggtg
gtgtcggggggtttgagtctgcgggacggcgcacgggtggtggtgtcgcggagtcggttg
atcgcgggtctgggtggtggtgggggcatggtgtcggtgagcctgcccgccgccgaggtg
gtgggtctgctgcccgccggggtgtcgttggcggcggtgaacggtccgtcgtcggtggtg
gtgtcgggcccgcgagcggcgctggccgagctggtcgccgactgtgagtcgcggaacgtg
cgggcgcggtggatcccggtggactacgcctcccactcggcggcgatcgaggagatccgc
gacgaactgatcaccgtcctcgccgagatcgacccgcaaccctcgacggtgccgttctac
tcctcggtgaccggcgcgccgagagccaccgagaccctggacgcgcggtactggttcgac
aatctgcgggagacggtgcggttcgatcgggcggtcgagtcgttgttgtcggatggtctc
ggcgtgttcgtggagtccagcgcgcatccggtgttgacctacggggtgcaggaggtcgcc
gacggtcgcgccgacgaccagaacaccctggtcgtcgggaccttacgtcgggatgacggc
gggttggatcggttcctggcctcggcgggggagctgttcgcccacggcatcgacctcgac
ctcacaccgttcctgacgggcggccgactcgtcgaactgccgacgtacgccttccaacgc
cgacgctactggctcgacactcccgcaaccaccggcgacgtcgacgccgtcggcctcgac
gccgccgaccatcccctgctcggcgcgaccgtccccgtcgcgggaacggacggactgatc
cacaccgggcggatctccgtcgcggaacagccctggctggccgaccacgtcgtcgacggc
gcggtgatcctccccggcaccgccttcgtcgaactgctcgtcagggccggcgagccgctc
ggctgcacccggctgcacgagttgacgttgcagacgccgatggtggtgcccgactccgga
gcgctacgcctccaggtcgtcgtcggcccgtcggacgacgacggcgcccgacccgtcggc
gtgcacacccgagacaccgacgacgccgccgcccactggaccacccacgccaccgggctg
ctgctgcctgccccgccgcaggccgacttcgcgctgacgcagtggccgccgaccggcgcc
gacccggtcgacgtcgagcacgtgtacggcggattcgccgagatcggcatgcactacggc
cccgtcttccaaggactccgccgcgcgtggcgccgtgccgacgagatcttcgccgaagtg
gtcctcaccgaggaggacggcgcgaccgcgcaccggttcggcgtgcatcccgcgctgctg
gacgcggcgctgcacaccttcgcgctcgcaggcataggcccgcaggagccgatcctgccg
ttcgcctggtccgacgtccggttcttcgccgcgggaggtgccgcactgcgggtgcgggtg
cgtcgactcggcgacgacacgatgtcgatccaggtcgccgacgccgccggcgccccggtg
ctgtcggcccgatcgctgaccgtgcgccccgcgacggctgctcggcccggcacggcccgc
cgcgactccctgttccgcgtcgagtggctgcccgcgacgggcggcgcccgacgaaccccg
gtgtcggtgatcgactgtcacgagcgcgacccgcgcaccgccgtccaccgcgtgttggcc
gaccttcaggcccggctggccgaggactcggacgaccgactcgtcgtgctgacccgaggc
gccgtcgccgtcaccccggaagagactcccgacctcgcgggagcggccgtgtgggggctc
gtgcgatcggcgcaggccgagcatcccggccgcatcgtgctactcgactccgacggcacc
gccgaccccgcgctgtcggccgcgctcgacgagccgcaggtggcggtgcgcggcgagcag
cccttcgtcgcgcgactgcgacgggtgtccgccgagggcgccgccgcctggaccgccgcg
ggaccgaccctgatcaccggcggcaccgggacgctgggcgccgccgtcgcccgacatctc
gtcgcccgacacggcgtccgcgacctcgtgctcgtcagcaggcggggccccgccgcaccg
ggggcgctgcgactgcgtgacgaactggtcggactcggcgcggccgtcgccgtggtcgcc
tgcgacgtctccgagcgcgaccaggtcgctcgactgctggccgaccacccggtcgacgcc
gtggtgcacgcggcggggaccctcgacgacggcgtggtgtccgcgttgacccccgagcgc
gtcgacgcggtgttcgccgcgaaggcggacgcggcctggcacctccacgaactcgcgggc
gaactgtcggcgttcgtgtccttctcctcggccgcgggcgtgatcggcagcgcgggtcag
gccaactacgcggcggccaacgccttcctcgacgccctggcccgacaccgacgagcgcag
gggctgcccggacagtccctggcctggggtctgtggtcgcagaccagcgagatgaccggc
gcgctggacgccgcggacgtgacacgcctgcaacgggcaggcatcgcccccatgtccacc
gaggacggcctggcacggttcgacgccgccctcggcgtcgacgacgcctcgcccgtgccg
ttccggctcgacctgacggccttccggcatgaggtgccgcgcctgttcaccgacctcgtg
cccgcccgcaggcgggcgaccccggcgaccgccacgacgctgtccgaacgcctggcgggg
ctggacgacacccgagcgaccgcgctgctcgtcgacctggtgcgtgcccaggcggcccgg
gtgctcgggcacgccacacccgaggccgtcgacaccatgcagccgttccagctgctcggc
ttcgactcgctcaccgcagtcgaactccgcaaccggctcaacgacgagaccggactgcgg
ctgcccgcgacgatggtgttcgaccacccgaccccggcaaccctcgccgacttcctccgc
gagcggctcctcggcaccgccgccgcacccgcacccgaggcgcccacgacgccgctctcg
gacgacccgatcgtcatcgtcggcatggcctgccgtttccccggcggcgtgaccgacccc
gacggcctgtggcggctgctcgccgacggcggcgaggtcgtcggcgacttcccgaccgac
cgaggctgggacctcgacgagctctacgaccccgagcccggcgtcccgggcaggagctac
acccgtgcgggcgggtttctggcggatgcggcggatttcgatgcggggttcttcgggatc
tcgcctcgggaggcgttggcgatggatccgcagcagcggttgttgttggaggcgtcgtgg
gaggtgatcgagcgggcgggggtggatccggtgtcgttgcgggggagtcggaccggcgtc
ttcaccgggctgatgtaccacgactatgcgtcccggctgccgcgagtacccgccgacgtc
gagggatacgcgggcaacggcaacgcgggcagcgtcgcctccggccgagtggcctacgcc
ctgggcctggagggggccgccgtcaccgtcgacacggcctgttcgtcctcgttggtcgcg
ctgcatctggccgcgcaggcgctgcgggcaggcgagtgcgacctcgcgatcgcgggcggc
gtcaccgccctcgcgacgccgggcgtgttcgtggagttctcccggcagcgtggactgtca
ccggacggccggtgcaagtcgttcgcgaacgcggcggacggcaccggctggtccgagggt
gtgggtctgttgttggtggagcggttgtcggatgcgcggaggctggggcaccgggtgttg
gcggtggtggcgggttcggcggtgaatcaggatggtgcgtcgaatgggttgacggcgccg
aatggtccgtcgcagcagcgggtgattcggcaggcgttggcttcggcgggggtgggtccg
tctgaggttgatgtggtggaggcgcatgggacgggtactcggttgggtgatccgatcgag
gcgcaggcggtgttggcgacctacgggcagggtcgtgagcggccgttgttgttgggttcg
gtgaagtcgaatctgggtcatacgcaggcggcggcgggtgtcgccggggtgatgaagatg
gtgctggccatgcaccacggcatcgtgccgcccaccctgcatgtggacgagccgacgcgc
gaggtggactggtcggccggtgccgtggaactggtcaccgaggcgcggccgtggccgatt
gacggtcggccgcgtcgggcgggggtgtcgtccttcggggtcagcggcaccaacgcccac
gtcatcctggaggcgccgcccgcgctggcggctgccgagtccgacggcgatcccgccgcg
tccgacggcgacggcgatcccaccgcaccccacggcgatcccgccgcgccgccgctcgtc
ccctgggtcctcaccggccggtcgcccgccgccctgcgtgcccaggccgaccggctcgcg
cgcctcctccaggaccggccggacctgcgcccgatcgacgtcggatcatccctggccaca
tcgcgatcgctcttcgaccaccgggtcctgctcaccggttcccaccgggacgacttcgca
gctgcgctcgcggagatcgccgccggcgcggtgccgtccgaggaacgccgagcgggctcg
ggtgtggtgttggtgtttccgggtcagggttcgcagtgggtggggatggcggtggggttg
gcggcggtgtcgtcggtgttcgctgctcggctgggtgagtgtgccgaggctttgtcggag
ttcgtggactggtcgttgcctgatgtgttgggtgatgaggctgcgttgtcgcgggttgat
gtggtgcagccggtgttgttcgcggtgatggtgtctctggccgaattgtggcgttcggtg
ggggtggttcctgctgcggtggtggggcattcgcagggtgagatcgcggcggcggtggtg
tcggggggtttgagtctgcgggacggcgcgcggatcgtggtgtcgcggagtcggttgatc
gcgggtctgggtggtggtgggggcatggtgtcggtgagccttcccgccgccgaggtggtg
gatctgctgcccgccggggtgtcgttggcggcggtgaacggtcccacgtcggtggtggtg
tccggttccgaacagtcgctggccgagctggtggccgactgtgagtcgcggaacgtgcgg
gcgcggtggattccggtggattacgcctcgcattcggtgttgatggacgcgttgcgcgac
gaactgctcgacgtcctcgccgggatcgaacctcgatcgtcgacggtgccgttctattcg
tcggtgaccggtgccgcgaaggacacggcctcgttggacgcgcggtactggttcgacaat
ctgcgggagacggtgcggttcgatcgggcggtcgagtcgttgttgtcggatggtctcggc
gtgttcgtggagtccagtgcgcatccggtgttgacctatgggatcggggaggtcgtcgag
gaacacggggccgagaacgtcctggtcgtcgggaccttacgtcgggatgacggcgggttg
gatcggttcctggcctcggcgggggagctgttcgcccacggcgtcgatctcgacctcaca
ccgttcctgacgggcggccgactcatcgacctgcccacctaccccttccaacgccaacgc
tactggctcgacacgccgaagggcttcgcgggcgacctgacctcgatcgggcagcgggac
accgaccatccgctgctcggggccgccgtcccgctggccgactccggcggggtggtgctc
accggacacgtgtcgatcgagacacacccgtggctggccgaccacgccgtcgcgggcacc
gtactgctgcccggcaccgccttcgtcgaactcgccgtccgcgcaggcgaccaggtgggc
tgcgggcgtgtggaggaactgaccctggaggcaccgctcgtcctcccacgtcacggcgcc
ctcgccctccacgtcctcgtcggagcccaggacgacgccggacttcgaccggtgagcgtg
tactcgcggcgcgccgccgacgacacggcctggacctgccacgccgtcgggcaactcggc
gccgacgtacccggccgagacctcgacctgacggcctggccccccgccgcggcgacggtc
gtgccgctggacggcctctacgagcggctgcacgaccggggctacgagtacgggccgacg
ttccaggggctccgcgcgatgtggcgcaccgagaaggaggtctacgccgaggtcacgctg
cccgacgacgcgatcacggattcgcccgcgttcgacctgcatccggcgctgctcgacgcc
gcactgcaccccgcgggcgccgccgcagccaccgacgacgtccggcttcccttcagctgg
tccggcgtctcggtccacgccgtcggcgcccgatcgctccgcgtccgactcaccctgcgg
ggcgagggcgtggtctccctcgacgccgccgaccagaccggcgcctccgtcgtctcggtg
gagtcgctcgccctgcgaccggtcgcccccgaacagctcgccgtcgcctcgaccgactcg
ctctaccagctcgactggtcgggaccgcgggagatcaaccccagcggcgccgccaccggt
cgctggatcggcggagccgacgacctggccgcgccgcccggcgagtccactccggacgtc
ctgctgctggacgccgcccgcgcgggcaccgccgacacgcccgcacgcgcccgacgggcc
gtcggcaccgtgctggacgtcctccgcgactggctcgccgacgacgacctcgccgacacc
cgcctggcggtggtcacccgatccgccgtgcgcgccgtcgacgacgacgtgcccgacccc
gccgcggcggcggtctgggggctggtgcgctccgcgcagaccgagaacccggaccggatc
gtgctgctcgacgtcgacgagcccgccgacgaccgagtcctcgtggcggcggcgatgaca
ggcggggagcaggccgcgatccgcgccgggcggctgtacctgccgcagctggtccgcggc
gggcccgccgagtcggcggcgccctcgtggggaccggcggggcgcgtcctgatcaccggc
ggcaccggcacgctcggcgccgccgtcgcccggcatctggtgtcgcgacacggagtccgc
agcctggtgctcgcgggccgccggggcccggacgccccgggcgccgccgcgctgcgcgag
gagctgaccggcctcggtgccgacgtcgtcgtcgaatcctgcgacctggccgaccgtgcg
gccgtggcccggctcctcgccgcacacccggtcacggcgatcgtgcacagcgcgggcgtg
ctcgacgacggggtggtgtccgcgctgaccccggagcgggtggacgcggtgttccgaccg
aaggtcgacgcggcatggcacctgcatgaactcgcgggtgaggtgtcggccttcgtgctg
ttctcctcggcgtcgggggtgttcgggacggcgggccagggcaactacgcggcggccaac
accttcctcgacgcgctcgccgagcaccggcgggcgcggggactgcccgcgcattcgctc
gcctggggctggtgggccgccaccagcgagctgaccgcccgactcggcaccgcggaccgg
acccggctgacccggcgtggcgtggtgccgctgtccaccgaggagggactggccctgttc
gacgccgccgtcgccgggacgcgacccgtggtgctgccggtgcggctcgacctgaccgcc
acactgcccgcggtatgccgagggttgcgtcgcgccgcgcgccgcaccgccgcggcaccc
gcggcgggcgaggcgacgctgctcgaccgtctcgccaggctcgatcgatccgaccgagac
gcggccctgctgaatctggtgcgcacgacggcggcggcggtgctcggccaccccaccctc
ggggaggtccgccccgcccgcgcgttcaaggacctcggcttcgactcgctcaccgccgtg
gaactgcgcaaccggctccaccgcgagaccggccgacgcctgcccgcgacgctggtgttc
gactacccgacgccgcaggcgatcgtcggattcctcaccgacgagttgttcggcaccgca
cccgcccagtcccccgtgctcgccgatctcgaccggctcgaagccggcctgaccgacgac
ctcgacgaggagacgcggtcgacgatcaccagcaggctgaaagccgtgatcgccaggtgg
gcgggcgacgccgcggacggctcgttcgtcgaccggctcgacacggcgtccgacgacgag
atcttcagcctgatcgacaacaggctcggccgaccctga

DBGET integrated database retrieval system